SecReT6
Immunity Protein ID: 53717707
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSL0068
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]76484..76852 [+]
Productlipoprotein
immunity typeProtein
Homologous immunityBTH_I0069
DescriptionTai2
UniProt IDQ63YX2
KEGG IDbps:BPSL0068
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 122 a.a.     [Download]
>gi|53717707|ref|YP_106693.1| lipoprotein [Burkholderia pseudomallei K96243]
MSWSKAACALFALSFLGCAGASGTAGSIDAGTQVCPVRAQSPLQYVDVFDGAPSDLATLIPDDAGERTGH
WELGYVYDAGRYVTIRCKYADGRTKDVRLAERVKRCDYRIDGKKTLQVTCAK
-
Nucleotide Sequence: 369 bp     [Download]
>gi|53717639|ref|NC_006350.1|:76484-76852 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGTCGTGGAGTAAGGCCGCCTGCGCGCTGTTCGCCCTGTCGTTCCTCGGATGCGCGGGCGCGTCCGGCA
CGGCGGGCTCGATCGACGCCGGCACGCAAGTGTGCCCGGTGCGGGCGCAAAGCCCGCTGCAATACGTCGA
CGTGTTCGACGGCGCGCCGAGCGATCTCGCGACGCTGATTCCCGACGACGCCGGCGAGCGCACAGGGCAT
TGGGAGCTCGGCTACGTGTACGACGCGGGGCGCTACGTGACGATCCGCTGCAAGTACGCGGACGGCCGGA
CCAAGGACGTCAGGCTCGCCGAGCGCGTGAAGCGCTGCGATTACCGGATCGACGGCAAGAAGACGCTGCA
GGTGACGTGCGCGAAGTGA
 Primer design