SecReT6
Immunity Protein ID: 53719661
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSL2048A
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]2449974..2450531 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityBTH_I2700
DescriptionBTH_I2700
UniProt IDQ63TB9
KEGG IDbps:BPSL2048A
PDB IDNA
Domain hit(s) vs Pfam DUF3304 [PF11745], Evalue: 9.20E-31, Aligned region: 10..140
Protein Sequence: 185 a.a.     [Download]
>gi|53719661|ref|YP_108647.1| hypothetical protein BPSL2048A [Burkholderia pseudomallei K96243]
MRGLALLGSVAACSRAVSEVSPQAGAKGAAVSQAGDDTMSLKLNALNDTDVPIGAFYVDGTWGSTVASRI
GSGGGQMICCASAPGKWHPGLTVTLRWQDDTLYKKDPDAMASRVVSVGKHEHFSDGFLWVLFFPNDRIKV
YASQWMPGFPGFPEGLQTPDSPCPEHFTRLSDDPRCSQPGKRIKL
-
Nucleotide Sequence: 558 bp     [Download]
>gi|53717639|ref|NC_006350.1|:c2450531-2449974 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
GTGCGCGGGCTTGCGCTGCTGGGGAGTGTTGCGGCGTGCTCGCGGGCGGTGAGCGAAGTGTCGCCGCAGG
CGGGCGCGAAAGGCGCGGCGGTGTCGCAGGCGGGCGACGACACGATGAGTCTGAAGCTGAATGCGTTGAA
CGATACGGATGTGCCGATCGGCGCATTTTACGTAGACGGTACGTGGGGCAGTACGGTTGCGTCGCGCATA
GGCAGCGGTGGCGGACAAATGATCTGCTGTGCGTCTGCGCCGGGTAAGTGGCATCCCGGCTTGACTGTCA
CGTTGCGGTGGCAAGACGACACGCTGTACAAGAAGGACCCGGACGCGATGGCGAGCCGGGTGGTTTCCGT
CGGGAAGCACGAGCATTTCTCCGACGGATTTCTATGGGTGCTGTTTTTTCCGAATGACAGGATCAAGGTG
TACGCATCGCAATGGATGCCCGGTTTTCCGGGGTTCCCGGAAGGGTTGCAGACGCCGGACAGCCCGTGTC
CGGAGCACTTCACGCGTCTGAGCGACGATCCGCGCTGTTCGCAGCCTGGCAAGAGAATCAAATTATGA
 Primer design