SecReT6
Immunity Protein ID: 537455113
SecReT6 ID844
T6SS typeA1
Gene symbol-
Locus tagN175_13415
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]2840727..2841455 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityVCA0021
DescriptionTsiV2
UniProt IDT1Y0W0
KEGG IDlag:N175_13415
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 242 a.a.     [Download]
>gi|537455113|ref|YP_008489049.1| hypothetical protein N175_13415 [Listonella anguillarum M3]
MLIDKDELEQLKANLHSSEVLYQWECVAFSERRGDIARWIIAVIAGFLLPSLFLVFGDIAFNSTEFWGFI
SFGLAGMSAGRYLLMPDHRYCYSLTQAGVHYTDQEVIPDAAYTFVRGFAWVGIVVCLLALAVVGPLAFVG
AGGFALLAFGLTNFHPTVHQKDVYFADQLIVFDPIKEKMVKLNSESRRHPRFSRTLFFSSFDEKTRFIEL
VKSVHNNVDYLPLRRVNDQYKHPIFNQELKEE
-
Nucleotide Sequence: 729 bp     [Download]
>gi|537452888|ref|NC_022223.1|:c2841455-2840727 Listonella anguillarum M3 chromosome 1, complete sequence
ATGTTAATTGATAAAGATGAGTTAGAGCAGTTAAAGGCAAATTTACACAGCAGTGAGGTTTTGTATCAGT
GGGAATGTGTGGCATTTTCAGAGCGACGAGGTGATATCGCTCGTTGGATTATTGCCGTCATTGCAGGCTT
TTTGCTTCCCTCACTATTTCTTGTGTTCGGGGATATTGCTTTTAACAGTACTGAGTTTTGGGGGTTTATC
AGCTTTGGCTTGGCGGGCATGTCGGCGGGAAGGTATCTTTTGATGCCCGACCACCGCTATTGTTACAGCT
TAACGCAAGCGGGTGTGCATTATACCGATCAAGAAGTGATCCCGGATGCGGCCTACACTTTTGTACGCGG
TTTTGCTTGGGTGGGGATTGTGGTCTGTTTGCTAGCCTTAGCCGTCGTTGGTCCGTTAGCGTTTGTTGGT
GCAGGCGGTTTTGCCCTGCTGGCCTTTGGTTTGACCAACTTCCATCCCACCGTACATCAGAAAGATGTTT
ACTTTGCTGACCAATTGATTGTTTTTGATCCGATCAAAGAAAAGATGGTGAAATTGAATTCCGAAAGCAG
AAGACATCCTCGATTTAGTAGAACACTTTTTTTTAGTTCCTTTGATGAAAAAACACGTTTTATTGAGCTC
GTGAAGAGTGTTCATAATAATGTCGACTATCTTCCGTTACGGCGAGTTAATGATCAGTACAAGCATCCTA
TCTTTAATCAAGAATTAAAAGAGGAATAG
 Primer design