SecReT6
Immunity Protein ID: 537457297
SecReT6 ID844
T6SS typeA1
Gene symbol-
Locus tagN175_18450
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]890092..890826 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVC1419
DescriptionTsiV1
UniProt IDT1Y3K6
KEGG IDlag:N175_18450
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 244 a.a.     [Download]
>gi|537457297|ref|YP_008489986.1| hypothetical protein N175_18450 [Listonella anguillarum M3]
MKFIANTNRKKRISIIVLFIALFFLGSDYYQTSQPNILGDEPDESYITISGKKPIDAYLEVWTHFWVTGD
ECEAYSYDLFGQKSHKGGKISQKITHNFAKDDSRYEFRIPYQTYKNEQNCIVELRDFSIQAYNKFDTVGF
AQLRVSPAGNEYYNRSIELGSSIEAKNCRARYYEDLDEWSTGLACSFYTNGKMKDKKDLVEFNAYTAYYD
FSKFNNDTVIHYDILAGENYRSEPLVQEQVAVAQ
-
Nucleotide Sequence: 735 bp     [Download]
>gi|537456627|ref|NC_022224.1|:890092-890826 Listonella anguillarum M3 chromosome 2, complete sequence
GTGAAATTTATCGCTAATACTAATAGGAAAAAAAGAATATCAATTATTGTACTATTCATCGCATTATTTT
TCCTTGGGTCTGATTATTACCAGACTTCTCAACCGAATATTTTGGGTGATGAACCTGATGAGTCCTATAT
TACTATATCAGGCAAAAAGCCTATAGATGCTTATTTAGAAGTTTGGACTCATTTTTGGGTGACAGGAGAT
GAGTGCGAGGCTTATTCCTACGATTTATTTGGTCAAAAATCCCATAAAGGAGGAAAGATAAGCCAAAAAA
TTACGCATAATTTTGCTAAAGATGATTCACGTTATGAATTTAGGATCCCTTACCAAACGTATAAAAATGA
ACAAAATTGTATAGTGGAATTAAGAGACTTTTCCATTCAAGCATACAACAAATTTGATACTGTTGGTTTT
GCCCAGTTACGAGTTTCACCAGCAGGCAATGAATATTATAATAGATCAATTGAGCTTGGTTCTTCTATTG
AAGCAAAAAACTGTAGAGCAAGATATTACGAAGACTTAGATGAATGGTCTACAGGCTTGGCTTGCAGTTT
TTATACTAATGGGAAAATGAAAGATAAAAAAGATTTAGTCGAATTTAACGCTTACACCGCCTACTACGAT
TTCTCGAAATTTAATAACGACACTGTGATTCATTACGATATTTTAGCCGGTGAGAATTACCGCTCTGAGC
CGTTAGTGCAAGAACAAGTCGCTGTAGCGCAATAA
 Primer design