SecReT6
Immunity Protein ID: 543974105
SecReT6 ID848
T6SS typeA1
Gene symbol-
Locus tagN646_3974
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]968662..969789 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVP1389
DescriptionVP1389
UniProt IDU3A850
KEGG IDvag:N646_3974
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 375 a.a.     [Download]
>gi|543974105|ref|YP_008548851.1| hypothetical protein N646_3974 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MNLRHTLCLITLAVLSGCNQESAKEPEQHAPKPQTVQDRIAEKNAQQWEDGRVYITENNYVIYDKETGKP
KHFIFKAKEWPREDLTNESSYDLPRVVFRWDNARNEAKDHYDQRDKVWSIKTDGTDLRLVADEFVGKVRL
MRVSPNNRYLALAYSASEGMFKVIKDLKTGEYIELGRSRGYPEFLWAEDSSYLYYVDKFKDWKYTLATGD
KQQVDTEFNEYSVIQKGKRYVLNDFGVAVYDEAKDEFLFSTGINPDEQNLGDYKFNKRSISPDGKYAWGE
SRKFRYLIDIEQDSFQQEEIVPRAVGKLRYFEILSKDANYARDGAARAILSKLKENKEFGSYLKWEQIGT
GHSASNSSLYNAFANNGGFVKGDEL
-
Nucleotide Sequence: 1128 bp     [Download]
>gi|543973209|ref|NC_022359.1|:968662-969789 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGAACCTACGTCATACATTATGCTTGATTACCTTAGCGGTCTTATCTGGTTGTAATCAAGAATCAGCCA
AGGAACCAGAACAACACGCGCCAAAACCTCAGACGGTTCAAGACCGAATCGCAGAAAAAAATGCTCAACA
GTGGGAAGATGGTCGTGTTTATATTACAGAAAACAATTACGTTATTTATGACAAAGAGACGGGTAAACCT
AAACACTTTATTTTTAAAGCTAAAGAATGGCCACGTGAAGATCTCACCAATGAAAGCTCTTATGATTTAC
CACGTGTAGTGTTTCGTTGGGATAACGCCCGAAATGAAGCGAAAGACCACTATGATCAAAGGGATAAAGT
GTGGAGTATCAAAACGGATGGGACGGACTTGCGTCTGGTCGCAGATGAGTTTGTTGGCAAAGTTCGTCTA
ATGCGTGTCTCTCCAAATAATCGCTACTTGGCTTTGGCCTATTCGGCCTCAGAAGGGATGTTTAAAGTAA
TTAAAGATCTTAAGACGGGTGAGTATATTGAACTAGGTCGTTCACGTGGCTACCCAGAGTTTCTATGGGC
AGAAGACAGCAGCTATCTTTACTACGTAGACAAGTTTAAAGACTGGAAGTACACCTTAGCGACAGGCGAC
AAACAGCAAGTAGACACAGAGTTTAATGAGTATTCCGTGATTCAAAAAGGAAAAAGATACGTACTAAACG
ACTTTGGCGTTGCAGTTTATGATGAGGCAAAAGACGAATTTCTCTTTAGCACGGGAATTAATCCTGATGA
ACAAAATCTGGGTGATTATAAGTTTAACAAACGTAGTATTAGTCCAGACGGTAAGTACGCTTGGGGTGAA
AGTAGGAAGTTTCGTTATCTAATTGATATCGAGCAGGATTCATTTCAACAAGAAGAAATTGTACCGCGAG
CGGTAGGTAAACTGCGCTATTTTGAAATTTTGAGTAAAGATGCGAATTATGCTCGGGATGGAGCGGCGCG
GGCCATCCTCAGTAAACTAAAAGAAAATAAAGAATTTGGTTCTTATTTAAAATGGGAGCAAATAGGGACG
GGCCATAGTGCCAGTAACTCTTCTCTTTACAACGCCTTTGCCAACAATGGTGGTTTTGTTAAAGGGGATG
AACTGTGA
 Primer design