SecReT6
Immunity Protein ID: 544577341
SecReT6 ID853
T6SS typeA2
Gene symbol-
Locus tagECOPMV1_03084
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3158307..3159140 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityAHW84488
DescriptionTli4
UniProt IDT2MUW5
KEGG IDecoi:ECOPMV1_03084
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 277 a.a.     [Download]
>gi|544577341|ref|YP_008572865.1| hypothetical protein ECOPMV1_03084 [Escherichia coli PMV-1]
MVKCHTLINRRNKCLLIVFIVLIGWIIFRPKAYTYSLNDKEKEMLIMLSQHPETRYFGFYSIELPADYKP
TGMVMFIQGSAMIPVETKLQYYPPFLQYMTRYEAELKNTSALDPLDTPYLKQVHPLSPPMNGVIFERMKA
KYTPDFARVLDAWKWENGVTFSVKIEAKDGRATRYDGISKIAEYSYGYNIPEKKVQLLTILSGLQPRADN
QPPSENKLAIQYAQVDASLLGEYELSVDYKNSNNIKISLQTDNNSYIDSLLDIRYPSNGNRAWYNSI
-
Nucleotide Sequence: 834 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3158307-3159140 Escherichia coli PMV-1 main chromosome, complete genome
ATGGTAAAATGTCATACTCTGATTAACCGTAGAAATAAATGTCTGCTGATTGTTTTTATAGTCCTTATTG
GATGGATTATATTCAGACCTAAAGCATATACTTATTCACTAAATGATAAAGAAAAAGAGATGCTCATAAT
GTTATCACAACATCCTGAAACTCGGTACTTTGGATTTTATTCCATAGAACTTCCGGCTGATTACAAACCA
ACAGGAATGGTTATGTTCATACAAGGATCGGCGATGATCCCTGTAGAAACAAAGCTACAATATTATCCTC
CTTTTCTGCAATATATGACACGATATGAGGCAGAACTAAAAAACACCTCAGCATTAGATCCACTGGATAC
GCCTTATTTGAAGCAAGTTCACCCACTAAGTCCACCTATGAATGGAGTCATTTTTGAACGAATGAAAGCG
AAATACACCCCAGATTTTGCACGAGTATTGGATGCATGGAAATGGGAAAATGGCGTTACGTTTTCAGTAA
AAATAGAAGCTAAAGATGGTAGAGCAACCCGCTATGATGGAATTAGTAAGATTGCCGAATACAGTTATGG
ATATAATATTCCAGAAAAAAAAGTACAGTTACTTACTATTCTTTCAGGACTACAACCTCGTGCAGATAAC
CAACCCCCATCAGAAAATAAATTGGCGATACAATATGCACAGGTTGACGCTTCACTACTTGGAGAGTATG
AATTATCTGTAGATTATAAAAATAGCAATAATATTAAAATAAGTTTGCAGACGGATAATAATAGTTATAT
TGACTCATTATTAGATATAAGATATCCGAGTAATGGAAACAGAGCATGGTATAACTCTATATAA
 Primer design