SecReT6
Immunity Protein ID: 558666450
SecReT6 ID871
T6SS typeA3
Gene symbol-
Locus tagPA1R_gp0492
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]610484..610768 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA0092
DescriptionTsi6
UniProt IDU6ANM3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 94 a.a.     [Download]
>gi|558666450|ref|YP_008803160.1| hypothetical protein PA1R_gp0492 [Pseudomonas aeruginosa PA1R]
MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPE
LSRALKDAYYVGIRTGRGLKVDLP
-
Nucleotide Sequence: 285 bp     [Download]
>gi|558665962|ref|NC_022806.1|:610484-610768 Pseudomonas aeruginosa PA1R, complete genome
ATGACACCCATCGAATACATCGACCGCGCTCTGGCGCTGGTCGTCGACCGGCTGGCCCGCTATCCGGGAT
ACGAGGTCCTGCTGTCCGCGGAAAAGCAATTGCAGTACATCAGGTCCGTCCTGCTCGACCGCAGCCTGGA
TCGTTCCGCACTGCACCGGTTGACCCTCGGCAGCATCGCCGTGAAGGAATTCGACGAAACCGACCCGGAA
CTCTCCAGGGCCCTCAAGGACGCCTACTACGTCGGTATACGCACTGGCCGCGGCCTGAAAGTCGATCTGC
CCTGA
 Primer design