SecReT6
Immunity Protein ID: 558666469
SecReT6 ID871
T6SS typeA3
Gene symbol-
Locus tagPA1R_gp0511
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]632324..632557 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2703
DescriptionTsi2
UniProt IDU6AND6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 77 a.a.     [Download]
>gi|558666469|ref|YP_008803179.1| hypothetical protein PA1R_gp0511 [Pseudomonas aeruginosa PA1R]
MNLKPQTLMVAIQCVAARTRELDAQLQNDDPQNAAELEQLLVGYDLAADDLKNAYEQALGQYSGLPPYDR
LIEDPVS
-
Nucleotide Sequence: 234 bp     [Download]
>gi|558665962|ref|NC_022806.1|:632324-632557 Pseudomonas aeruginosa PA1R, complete genome
ATGAACCTGAAACCCCAGACCCTGATGGTGGCGATCCAGTGCGTCGCCGCGCGCACCCGCGAACTCGACG
CGCAGTTGCAGAACGACGACCCGCAGAACGCCGCTGAACTCGAACAGTTGCTGGTCGGCTACGACCTCGC
CGCCGACGACCTGAAGAACGCCTACGAGCAAGCCCTGGGCCAATACAGCGGCCTGCCGCCCTATGACCGG
CTGATCGAAGACCCGGTGTCCTGA
 Primer design