SecReT6
Immunity Protein ID: 558667264
SecReT6 ID871
T6SS typeA3
Gene symbol-
Locus tagPA1R_gp1326
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]1490622..1491059 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA3485
DescriptionTsi3
UniProt IDU6AQM5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|558667264|ref|YP_008803974.1| hypothetical protein PA1R_gp1326 [Pseudomonas aeruginosa PA1R]
MKTVALILASLALLACTAESGVDFDKTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLRNPRQLEVQRQ
DAPPPPDLASRRLGDGEARYKVEEDDGGSAGSEYRLWAAKPAGARWIVVSASEQSEDGEPTFALAWALLE
RARLQ
-
Nucleotide Sequence: 438 bp     [Download]
>gi|558665962|ref|NC_022806.1|:1490622-1491059 Pseudomonas aeruginosa PA1R, complete genome
ATGAAGACAGTCGCCCTGATTCTCGCCAGCCTCGCCCTGCTGGCCTGCACCGCGGAGTCCGGGGTGGACT
TCGACAAGACCCTGACCCACCCGAACGGCCTGGTGGTGGAGCGCCCCGTTGGCTTCGACGCGCGGCGCAG
CGCCGAGGGCTTCCGCTTCGACGAAGGCGGCAAGCTGCGCAACCCACGCCAACTGGAGGTCCAGCGCCAG
GACGCGCCGCCCCCGCCCGACCTGGCGAGCAGGCGCCTGGGCGACGGCGAGGCGCGCTACAAGGTAGAGG
AAGACGACGGCGGCTCCGCAGGCAGCGAATACCGCCTGTGGGCAGCCAAGCCGGCGGGCGCGCGGTGGAT
CGTGGTCAGCGCCAGCGAGCAGAGCGAGGATGGCGAACCGACCTTCGCCCTGGCCTGGGCGCTGCTGGAG
CGGGCCAGGTTGCAGTGA
 Primer design