SecReT6
Immunity Protein ID: 558668923
SecReT6 ID870
T6SS typeA4a
Gene symbol-
Locus tagPA1R_gp3012
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]3370821..3371348 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5087
DescriptionPA5087
UniProt IDU6AWF1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 1.60E-12, Aligned region: 45..52
Sel1 [PF08238], Evalue: 1.60E-12, Aligned region: 65..76
Sel1 [PF08238], Evalue: 1.60E-12, Aligned region: 78..108
Sel1 [PF08238], Evalue: 1.60E-12, Aligned region: 115..150
Sel1 [PF08238], Evalue: 1.60E-12, Aligned region: 151..163
Protein Sequence: 175 a.a.     [Download]
>gi|558668923|ref|YP_008805633.1| hypothetical protein PA1R_gp3012 [Pseudomonas aeruginosa PA1R]
MRLMAIGLWAVLCLAAVPVMANSKSFVCVNEKDHLPPLDSQADVWYREAAALAKPDTLRPWGRIVELYSK
AVERGHWKAMHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLKIPQGFYNMGAMIGNRAGVKNPATDGLT
FLDKAASLGNPPALTELGKLYIYVAKKKGFGVGVY
-
Nucleotide Sequence: 528 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c3371348-3370821 Pseudomonas aeruginosa PA1R, complete genome
ATGCGGCTGATGGCTATTGGACTTTGGGCCGTGCTGTGTCTTGCAGCCGTTCCCGTGATGGCCAACAGCA
AATCGTTTGTCTGCGTTAATGAAAAAGACCATCTGCCGCCGTTGGATTCGCAAGCCGATGTCTGGTACCG
CGAAGCAGCCGCCTTGGCCAAGCCCGATACTCTGCGGCCCTGGGGCCGTATCGTCGAGCTTTACAGCAAG
GCAGTGGAGCGTGGCCACTGGAAGGCCATGCATAACTTGGCGAACCTCTATCGTACCGGTTGGCCGGGAG
GTGTGGAGAAGGACACTCAGAAAGCTCTAGACCTTTACCAGAAAATGATCGATCTGAAGATTCCTCAAGG
TTTCTATAATATGGGGGCAATGATCGGTAATCGTGCCGGGGTCAAGAATCCTGCAACTGACGGACTTACT
TTTCTTGATAAGGCTGCTAGCCTAGGAAATCCGCCGGCGCTAACCGAACTAGGTAAGCTTTATATATATG
TGGCCAAAAAAAAAGGATTTGGGGTTGGCGTATACTAA
 Primer design