SecReT6
Immunity Protein ID: 558668924
SecReT6 ID870
T6SS typeA4a
Gene symbol-
Locus tagPA1R_gp3013
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]3371348..3372226 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5087
DescriptionPA5087
UniProt IDU6AVF3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 1.60E-16, Aligned region: 44..52
Sel1 [PF08238], Evalue: 1.60E-16, Aligned region: 65..76
Sel1 [PF08238], Evalue: 1.60E-16, Aligned region: 78..113
Sel1 [PF08238], Evalue: 1.60E-16, Aligned region: 115..150
Sel1 [PF08238], Evalue: 1.60E-16, Aligned region: 151..183
Sel1 [PF08238], Evalue: 1.60E-16, Aligned region: 184..216
TPR_7 [PF13176], Evalue: 0.0014, Aligned region: 41..54
TPR_7 [PF13176], Evalue: 0.0014, Aligned region: 79..112
TPR_7 [PF13176], Evalue: 0.0014, Aligned region: 153..176
TPR_7 [PF13176], Evalue: 0.0014, Aligned region: 200..218
Protein Sequence: 292 a.a.     [Download]
>gi|558668924|ref|YP_008805634.1| hypothetical protein PA1R_gp3013 [Pseudomonas aeruginosa PA1R]
MRLMAIGLWAVLCLAAVPVMANSKSFVCVNEKDHLPPLDSQADAWYREAAALAKPDTLRPWGRIVELYSK
AVERGHWKAMHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLGVPQGFYNMGAMIGNRAGVKNPATDGLT
FLDKAASMGNPPALTALGKLYIYEANQDELGLRYTQCAAEQGYAPANYELGAYYKIVKHNYPKALSYYQL
ATSQGDGDAALLMTDIFDEKSRPVDRMWYDADKELYEMYYSIYKKLEVDPDLRFTNLIKDHPLPPHPTQG
YDADRPDWKPEQ
-
Nucleotide Sequence: 879 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c3372226-3371348 Pseudomonas aeruginosa PA1R, complete genome
ATGCGGCTGATGGCTATTGGACTTTGGGCCGTGCTCTGTCTTGCAGCCGTTCCCGTGATGGCCAACAGCA
AATCGTTTGTCTGCGTTAATGAGAAAGACCATTTGCCGCCGTTGGATTCGCAAGCCGATGCTTGGTACCG
CGAAGCAGCAGCCTTGGCCAAGCCAGATACTCTACGGCCCTGGGGCCGTATCGTCGAGCTTTACAGCAAG
GCAGTGGAGCGTGGTCACTGGAAGGCCATGCATAACCTGGCGAATCTTTATCGTACAGGGTGGCCTGGTG
GGGTAGAGAAGGATACGCAGAAAGCGTTGGACCTTTACCAGAAGATGATCGATCTGGGAGTGCCCCAAGG
CTTCTATAACATGGGGGCAATGATTGGCAATCGTGCCGGTGTTAAGAATCCTGCTACCGATGGCCTGACC
TTCTTGGACAAGGCCGCCAGTATGGGTAACCCTCCAGCCTTAACTGCGTTAGGTAAGCTTTATATTTATG
AAGCGAATCAGGACGAACTAGGACTTCGTTACACGCAATGCGCTGCTGAGCAAGGATATGCTCCCGCTAA
TTATGAATTGGGTGCGTATTACAAAATAGTTAAGCATAATTATCCTAAGGCGCTGAGCTATTACCAGCTT
GCTACTTCTCAAGGGGATGGTGATGCTGCGCTTCTAATGACAGATATATTCGATGAAAAAAGTCGACCAG
TTGATAGGATGTGGTATGACGCGGATAAGGAGCTTTATGAGATGTATTACTCTATTTACAAGAAGCTTGA
AGTTGATCCAGATCTACGTTTTACCAACTTGATAAAGGATCATCCTCTGCCTCCTCACCCGACCCAGGGC
TACGACGCAGATCGGCCCGACTGGAAACCGGAGCAATGA
 Primer design