SecReT6
Immunity Protein ID: 558668926
SecReT6 ID870
T6SS typeA4a
Gene symbol-
Locus tagPA1R_gp3015
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]3373104..3373979 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5088
DescriptionPA5088
UniProt IDU6AXZ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 43..51
Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 64..75
Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 77..107
Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 114..149
Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 151..182
Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 183..215
Protein Sequence: 291 a.a.     [Download]
>gi|558668926|ref|YP_008805636.1| hypothetical protein PA1R_gp3015 [Pseudomonas aeruginosa PA1R]
MRISIYLFTFLLSFGVSVMADSKSFVCVNEKDHLPPLDSQADAWYREAAALAKPDTLRPWGRIVELYSKA
VERGHWKAMHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLKIPQGFYNMGAMIGNRAGVNNPATDGLTF
LDKAASLGNPPALTELGKLYIYVAKNRELGLAYTQCAASQGYAPANYELGSYYELVEHNFPKAARYYLLA
ASQGNDDAALFMSGVFDKTSPDVDRMWYSPDEKLHKEYYSIYKKLEADPDLRFPNLMKEHPLPPHPTQGY
DADRPDWKPEQ
-
Nucleotide Sequence: 876 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c3373979-3373104 Pseudomonas aeruginosa PA1R, complete genome
ATGCGTATCTCTATTTATCTGTTCACTTTCCTGCTGAGTTTCGGAGTTTCCGTTATGGCCGACAGCAAAT
CATTCGTCTGCGTTAATGAAAAAGACCATCTTCCTCCGTTGGATTCGCAAGCCGATGCTTGGTACCGCGA
AGCAGCCGCCTTGGCCAAGCCCGATACTCTGCGGCCCTGGGGCCGTATCGTCGAGCTTTACAGCAAGGCA
GTGGAGCGTGGCCACTGGAAGGCCATGCATAACTTGGCGAACCTCTATCGTACCGGTTGGCCGGGAGGTG
TGGAGAAGGACACTCAGAAAGCTCTAGACCTTTACCAGAAAATGATCGATCTGAAGATTCCTCAAGGTTT
CTATAATATGGGGGCAATGATCGGTAATCGTGCCGGGGTCAATAATCCTGCAACTGATGGTCTTACTTTT
CTTGATAAGGCTGCTAGCCTAGGAAATCCGCCGGCGCTAACCGAACTGGGTAAGCTTTATATTTATGTGG
CCAAAAACAGAGAGTTGGGTTTGGCATATACCCAATGTGCTGCGAGTCAGGGTTATGCTCCGGCAAACTA
TGAGTTGGGGAGTTACTACGAACTCGTTGAACACAACTTTCCAAAAGCAGCAAGATATTATCTTCTTGCT
GCCAGTCAAGGAAATGATGATGCTGCCCTCTTCATGTCCGGAGTTTTTGATAAGACCAGTCCCGATGTTG
ACAGAATGTGGTACTCCCCCGATGAAAAACTACACAAGGAATATTATTCAATCTATAAAAAGCTTGAAGC
TGATCCTGATTTACGTTTTCCCAACCTGATGAAGGAGCATCCGTTACCACCTCATCCCACTCAGGGCTAC
GACGCAGATCGGCCTGACTGGAAACCGGAGCAGTGA
 Primer design