SecReT6
Immunity Protein ID: 558669510
SecReT6 ID871
T6SS typeA3
Gene symbol-
Locus tagPA1R_gp3606
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]4041767..4042051 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA0092
DescriptionTsi6
UniProt IDU6ANM3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 94 a.a.     [Download]
>gi|558669510|ref|YP_008806220.1| hypothetical protein PA1R_gp3606 [Pseudomonas aeruginosa PA1R]
MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPE
LSRALKDAYYVGIRTGRGLKVDLP
-
Nucleotide Sequence: 285 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c4042051-4041767 Pseudomonas aeruginosa PA1R, complete genome
ATGACACCCATCGAATACATCGACCGCGCTCTGGCGCTGGTCGTCGACCGGCTGGCCCGCTATCCGGGAT
ACGAGGTCCTGCTGTCCGCGGAAAAGCAATTGCAGTACATCAGGTCCGTCCTGCTCGACCGCAGCCTGGA
TCGTTCCGCACTGCACCGGTTGACCCTCGGCAGCATCGCCGTGAAGGAATTCGACGAAACCGACCCGGAA
CTCTCCAGGGCCCTCAAGGACGCCTACTACGTCGGTATACGCACTGGCCGCGGCCTGAAAGTCGATCTGC
CCTGA
 Primer design