SecReT6
Immunity Protein ID: 558671356
SecReT6 ID871
T6SS typeA3
Gene symbol-
Locus tagPA1R_gp5471
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]6069732..6070250 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA1845
DescriptionTsi1
UniProt IDU6B4X0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 172 a.a.     [Download]
>gi|558671356|ref|YP_008808066.1| hypothetical protein PA1R_gp5471 [Pseudomonas aeruginosa PA1R]
MKLLAGSFAALFLSLSAQAADCTFTQLEIVPQFGSPNMFGGEDEHVRVMFSNEDPNDDNPDAFPEPPVYL
ADRDSGNDCRIEDGGIWSRGGVFLSQDGRRVLMHEFSGSSAELVSYDSATCKVVHREDISGQRWAVDKDG
LRLGEKCSGESVDSCAKIVTRSLAPFCQTAKK
-
Nucleotide Sequence: 519 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c6070250-6069732 Pseudomonas aeruginosa PA1R, complete genome
ATGAAACTGCTCGCCGGCAGCTTCGCCGCTCTCTTCCTGAGCCTTTCGGCCCAGGCGGCGGACTGTACTT
TCACCCAGCTGGAAATCGTGCCCCAGTTCGGCTCGCCGAACATGTTTGGCGGCGAGGACGAGCACGTCCG
CGTGATGTTCAGCAACGAGGATCCCAACGACGACAACCCCGATGCCTTTCCCGAACCGCCGGTCTACCTG
GCCGACCGCGACAGCGGCAACGATTGCCGCATAGAGGACGGCGGCATCTGGTCGCGCGGCGGCGTGTTCC
TGAGCCAGGACGGCCGGCGCGTGCTGATGCATGAATTCAGCGGCTCCAGCGCCGAGCTGGTGTCCTACGA
CAGCGCCACCTGCAAGGTGGTGCACCGCGAGGACATCTCCGGCCAGCGCTGGGCGGTGGACAAGGACGGG
CTGCGCCTGGGAGAGAAATGCTCGGGCGAATCCGTCGACAGCTGCGCGAAGATCGTGACGCGTTCCCTCG
CGCCGTTCTGCCAGACCGCAAAGAAATGA
 Primer design