SecReT6
Immunity Protein ID: 558675274
SecReT6 ID873
T6SS typeA4a
Gene symbol-
Locus tagPA1S_gp3012
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]3370821..3371348 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5087
DescriptionPA5087
UniProt IDU6ADQ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 1.60E-12, Aligned region: 45..52
Sel1 [PF08238], Evalue: 1.60E-12, Aligned region: 65..76
Sel1 [PF08238], Evalue: 1.60E-12, Aligned region: 78..108
Sel1 [PF08238], Evalue: 1.60E-12, Aligned region: 115..150
Sel1 [PF08238], Evalue: 1.60E-12, Aligned region: 151..163
Protein Sequence: 175 a.a.     [Download]
>gi|558675274|ref|YP_008811982.1| hypothetical protein PA1S_gp3012 [Pseudomonas aeruginosa PA1]
MRLMAIGLWAVLCLAAVPVMANSKSFVCVNEKDHLPPLDSQADVWYREAAALAKPDTLRPWGRIVELYSK
AVERGHWKAMHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLKIPQGFYNMGAMIGNRAGVKNPATDGLT
FLDKAASLGNPPALTELGKLYIYVAKKKGFGVGVY
-
Nucleotide Sequence: 528 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c3371348-3370821 Pseudomonas aeruginosa PA1, complete genome
ATGCGGCTGATGGCTATTGGACTTTGGGCCGTGCTGTGTCTTGCAGCCGTTCCCGTGATGGCCAACAGCA
AATCGTTTGTCTGCGTTAATGAAAAAGACCATCTGCCGCCGTTGGATTCGCAAGCCGATGTCTGGTACCG
CGAAGCAGCCGCCTTGGCCAAGCCCGATACTCTGCGGCCCTGGGGCCGTATCGTCGAGCTTTACAGCAAG
GCAGTGGAGCGTGGCCACTGGAAGGCCATGCATAACTTGGCGAACCTCTATCGTACCGGTTGGCCGGGAG
GTGTGGAGAAGGACACTCAGAAAGCTCTAGACCTTTACCAGAAAATGATCGATCTGAAGATTCCTCAAGG
TTTCTATAATATGGGGGCAATGATCGGTAATCGTGCCGGGGTCAAGAATCCTGCAACTGACGGACTTACT
TTTCTTGATAAGGCTGCTAGCCTAGGAAATCCGCCGGCGCTAACCGAACTAGGTAAGCTTTATATATATG
TGGCCAAAAAAAAAGGATTTGGGGTTGGCGTATACTAA
 Primer design