SecReT6
Immunity Protein ID: 558675276
SecReT6 ID873
T6SS typeA4a
Gene symbol-
Locus tagPA1S_gp3014
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]3372226..3373104 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5087
DescriptionPA5087
UniProt IDU6AGB2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 1.20E-13, Aligned region: 41..52
Sel1 [PF08238], Evalue: 1.20E-13, Aligned region: 65..76
Sel1 [PF08238], Evalue: 1.20E-13, Aligned region: 78..108
Sel1 [PF08238], Evalue: 1.20E-13, Aligned region: 116..150
Sel1 [PF08238], Evalue: 1.20E-13, Aligned region: 152..183
Sel1 [PF08238], Evalue: 1.20E-13, Aligned region: 185..216
Protein Sequence: 292 a.a.     [Download]
>gi|558675276|ref|YP_008811984.1| hypothetical protein PA1S_gp3014 [Pseudomonas aeruginosa PA1]
MRLMAIGLWAVLCLAAVPVMANSKSFVCVNEKGHLPPLDSQADAWYREAAALAKPDTLRPWGRIVELYSK
AVERGHWKAMHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLKIPQGFYDMGAMIGNRAGVKNPATDGLT
FLDKAASLGNPPALTELGKLYIYVAKKKDLGLAYTNCAASQGYSPANYELGAYYKIVEHNFPKAASYYLL
AASQGNGDAAFFMSGVFDKASPDVDRMWYSPDERLHKEYYSIYKKLEADPDLRFPNLMKEHPLPPHPTQG
YDADRPDWKPEQ
-
Nucleotide Sequence: 879 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c3373104-3372226 Pseudomonas aeruginosa PA1, complete genome
ATGCGGCTGATGGCTATTGGACTTTGGGCCGTGCTGTGTCTTGCAGCCGTCCCCGTGATGGCCAACAGCA
AATCGTTTGTCTGCGTTAATGAAAAAGGCCATCTGCCGCCGTTGGATTCGCAAGCCGATGCTTGGTACCG
CGAAGCAGCAGCCTTGGCTAAGCCCGATACTCTGCGGCCCTGGGGCCGTATCGTCGAGCTTTACAGCAAG
GCAGTGGAGCGTGGCCACTGGAAGGCCATGCATAACTTGGCGAACCTCTATCGTACCGGTTGGCCGGGAG
GTGTGGAGAAGGACACTCAGAAAGCTCTAGACCTTTACCAGAAAATGATCGATCTGAAGATTCCTCAAGG
TTTCTATGATATGGGGGCAATGATCGGTAATCGTGCCGGGGTCAAGAATCCTGCAACGGATGGACTTACC
TTCCTGGATAAGGCCGCCAGCTTGGGAAATCCGCCGGCATTGACTGAGCTTGGAAAGCTTTATATTTATG
TAGCTAAGAAGAAAGATTTGGGTTTGGCGTATACCAATTGCGCTGCCAGTCAGGGTTATTCACCGGCTAA
TTATGAGTTAGGGGCGTATTATAAGATAGTAGAGCATAACTTCCCCAAGGCGGCGAGCTATTATCTTCTT
GCTGCCAGTCAAGGAAATGGTGATGCTGCCTTCTTCATGTCCGGAGTTTTTGATAAGGCTAGTCCCGATG
TTGACAGGATGTGGTACTCCCCCGACGAAAGACTACACAAGGAATATTATTCAATCTATAAAAAGCTTGA
GGCTGATCCTGATTTACGTTTTCCCAACCTGATGAAGGAGCATCCGTTACCACCCCATCCCACTCAGGGC
TACGACGCAGATCGGCCCGACTGGAAACCGGAGCAGTGA
 Primer design