SecReT6
Immunity Protein ID: 558675277
SecReT6 ID873
T6SS typeA4a
Gene symbol-
Locus tagPA1S_gp3015
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]3373104..3373979 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5088
DescriptionPA5088
UniProt IDU6AGY0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 43..51
Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 64..75
Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 77..107
Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 114..149
Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 151..182
Sel1 [PF08238], Evalue: 5.60E-16, Aligned region: 183..215
Protein Sequence: 291 a.a.     [Download]
>gi|558675277|ref|YP_008811985.1| hypothetical protein PA1S_gp3015 [Pseudomonas aeruginosa PA1]
MRISIYLFTFLLSFGVSVMADSKSFVCVNEKDHLPPLDSQADAWYREAAALAKPDTLRPWGRIVELYSKA
VERGHWKAMHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLKIPQGFYNMGAMIGNRAGVNNPATDGLTF
LDKAASLGNPPALTELGKLYIYVAKNRELGLAYTQCAASQGYAPANYELGSYYELVEHNFPKAARYYLLA
ASQGNDDAALFMSGVFDKTSPDVDRMWYSPDEKLHKEYYSIYKKLEADPDLRFPNLMKEHPLPPHPTQGY
DADRPDWKPEQ
-
Nucleotide Sequence: 876 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c3373979-3373104 Pseudomonas aeruginosa PA1, complete genome
ATGCGTATCTCTATTTATCTGTTCACTTTCCTGCTGAGTTTCGGAGTTTCCGTTATGGCCGACAGCAAAT
CATTCGTCTGCGTTAATGAAAAAGACCATCTTCCTCCGTTGGATTCGCAAGCCGATGCTTGGTACCGCGA
AGCAGCCGCCTTGGCCAAGCCCGATACTCTGCGGCCCTGGGGCCGTATCGTCGAGCTTTACAGCAAGGCA
GTGGAGCGTGGCCACTGGAAGGCCATGCATAACTTGGCGAACCTCTATCGTACCGGTTGGCCGGGAGGTG
TGGAGAAGGACACTCAGAAAGCTCTAGACCTTTACCAGAAAATGATCGATCTGAAGATTCCTCAAGGTTT
CTATAATATGGGGGCAATGATCGGTAATCGTGCCGGGGTCAATAATCCTGCAACTGATGGTCTTACTTTT
CTTGATAAGGCTGCTAGCCTAGGAAATCCGCCGGCGCTAACCGAACTGGGTAAGCTTTATATTTATGTGG
CCAAAAACAGAGAGTTGGGTTTGGCATATACCCAATGTGCTGCGAGTCAGGGTTATGCTCCGGCAAACTA
TGAGTTGGGGAGTTACTACGAACTCGTTGAACACAACTTTCCAAAAGCAGCAAGATATTATCTTCTTGCT
GCCAGTCAAGGAAATGATGATGCTGCCCTCTTCATGTCCGGAGTTTTTGATAAGACCAGTCCCGATGTTG
ACAGAATGTGGTACTCCCCCGATGAAAAACTACACAAGGAATATTATTCAATCTATAAAAAGCTTGAAGC
TGATCCTGATTTACGTTTTCCCAACCTGATGAAGGAGCATCCGTTACCACCTCATCCCACTCAGGGCTAC
GACGCAGATCGGCCTGACTGGAAACCGGAGCAGTGA
 Primer design