SecReT6
Immunity Protein ID: 76808937
SecReT6 ID91
T6SS typeA4b
Gene symbol-
Locus tagBURPS1710b_0292
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]299201..299569 [+]
Productlipoprotein
immunity typeProtein
Homologous immunityBTH_I0069
DescriptionTai2
UniProt IDQ3JXJ5
KEGG IDbpm:BURPS1710b_0292
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 122 a.a.     [Download]
>gi|76808937|ref|YP_331708.1| lipoprotein [Burkholderia pseudomallei 1710b]
MSWSKAACALFALSFLGCAGASGTAGSIDAGTQVCPVRAQSPLQYVDVFDGAPSDLATLIPDDAGERTGH
WELGYVYDAGRYVTIRCKYADGRTKDVRLAERVKRCDYRIDGKKTLQVTCAK
-
Nucleotide Sequence: 369 bp     [Download]
>gi|76808520|ref|NC_007434.1|:299201-299569 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGTCGTGGAGTAAGGCCGCCTGCGCGCTGTTCGCCCTGTCGTTCCTCGGATGCGCGGGCGCGTCCGGCA
CGGCGGGCTCGATCGACGCCGGCACGCAAGTGTGCCCGGTGCGGGCGCAAAGCCCGCTGCAATACGTCGA
CGTGTTCGACGGCGCGCCGAGCGATCTCGCGACGCTGATCCCCGACGACGCCGGCGAGCGCACAGGGCAT
TGGGAGCTCGGCTACGTGTACGACGCGGGGCGCTACGTGACGATCCGCTGCAAGTACGCGGACGGCCGGA
CCAAGGACGTCAGGCTCGCCGAGCGCGTGAAGCGCTGCGATTACCGGATCGACGGCAAGAAGACGCTGCA
GGTGACGTGCGCGAAGTGA
 Primer design