Home 
Browse by Thiopeptide |   Genotype  |   Gene Cluster |   Precursor Peptide |   Nosiheptide Genes |   Organism
The precursor peptide is converded into a thiopeptide antibiotic by the posttranslational modifications.
Here is the list of the reported or predicted precursor peptides.
 #Gene SymbolSequenceGene Cluster
 nosMMDAAHLSDLDIDALEISEFLDESRLEDSEVVAKVMSASCTTCECCCSCSS
 gene clusterexperimental 
 nocMMSADLSALNIDSLEISEFLDDSRLEDSEVVAKVMSASCTTCECSCSCSS
 gene clusterexperimental 
 tsrHMSNAALEIGVEGLTGLDVDTLEISDYMDETLLDGEDLTVTMIASASCTTC
ICTCSCSS
 gene clusterexperimental 
 sioHMSTAAIVGQEIGVDGLTGLDVDALEISDYMDETLLDGEDLSVTMVSSASC
TTCICTCSCSS
 gene clusterexperimental 
 cltAMEKELVLDLADLSVDELDVLPTSPGAGLESINVGHAMVEIGASNCTSTGT
PASCCSCCCC
 gene clusterexperimental 
 tpdAMDLSDLPMDVFELADDGVAVESLTAGHGMTEVGASCNCFCYICCSCSSA
 gene clusterexperimental 
 tpdAMSELESKLNLSDLPMDVFEMADSGMEVESLTAGHGMPEVGASCNCVCGFC
CSCSPSA
 gene clusterexperimental 
 tpaXMNHEIDLSAIEISDLVHEVEQGEDTFSQVMAASCVGTACTCSSTSSST
 gene clusterexperimental 
 tpaAMNKDIDLSAIEISDLISETEQSDDALSQVMAASCTTTGCACSSSSSST
 gene clusterexperimental 
10  BC5087MSEIKKALNTLEIEDFDAIEMVDVDAMPENEALEIMGASCTTCVCTCSCC
TT
 gene clusterexperimental 
11  BC5088MSEIKKALNTLEIEDFDAIEMVDVDAMPENEALEIMGASCTTCVCTCSCC
TT
 gene clusterexperimental 
12  BC5089MSEIKKALNTLEIEDFDAIEMVDVDAMPENEALEIMGASCTTCVCTCSCC
TT
 gene clusterexperimental 
13  BC5090MSEIKKALNTLEIEDFDAIEMVDVDAMPENEALEIMGASCTTCVCTCSCC
TT
 gene clusterexperimental 
14  orf_propep *MENETLDLDVMELADIIGSASDQDDMAQVMAASCTTTSVSTSSSSSS
 gene cluster 
15  Caci_4200METFDTPTSGTLVSLAMELTALDSETFEIQDYAEYDGLMGAAGKAPVGGV
QGGGDGNHATSTSSTSTCST CSTTSCCA
 gene cluster 
16  Strop_2417MENDTDLNALADEILELESETFAISDYADASEAILASCSSSATTSTCSST
TSTTSCSA
 gene cluster 
17  Sare_2569MAPETDLNALAEEILELESETFAISDYADASEAILASCSSSATTSTCSST
TSTTSCSA
 gene cluster 
18  SGR_4418MAPKTELATLADEILELESETFEISDYSDASEVVLAGSTSCSSTSTCSST
TSTTSCSA
 gene cluster 
19  Tbis_0549MDLNDLPMDVFELADSGVAVESLTAGHGMTEVGASCNCFCYICCSCSSA
 gene cluster 
20  Amir_3860MDLTFDESELDLGDLAVTAMRDAVALPETGASTAACSCSSTSCCCCQQPP
TPELPQV
 gene cluster 
21  VAB18032_21150MPITLNDELRELETETFEIEEVADGEEMLAATSSSCSCSSCCSCSTSSCC
STSTSTSSCG
 gene cluster 
22  orf_propep *MPELTEELRALETETFEIEDVDAIDAMVMDWSSSSCSCSSCCSCSTSSCC
SSSTSTGCGGG
 gene cluster 
23  orf_propep *MSALASEKPMDDKLFAGFDIEELEVLEVSDSVALPEMGASSGSGILCCSS
SSSSSSSCC
 gene cluster 
24  MCAG_03948MPPTHPDTALCGWRAIHRKRIEQRKEERMDANATTVGVDGLTGLDIDTFE
IGDYLDETVLDTADLTETMT SSSSCTTCICTCSCSS
 gene cluster 
25  SSNG_06371MEKSPLASLADEILELESETFEISDYSDASEVVLAGSTSCSSTSTCSSTT
STTSCSA
 gene cluster 
26  SACT1_4717MAPKTELATLADEILELESETFEISDYSDASEVVLAGSTSCSSTSTCSST
TSTTSCSA
 gene cluster 
27  SSHG_03904MDPWDRREYAMTPKTELATLADEILELESETFEISDYSDAAEVVLAGSTS
CSSTSTCSSTTSTTSCSA
 gene cluster 
28  HMPREF0514_11728(frr2)MKGGVKMKDLFDIDEKSLENLDLGDFKILDSEDLSEKDEKSILGASCTTC
TCCCSCCA
 gene cluster 
29  SSDG_06102MSIDDIKNNGDDAAKAFESFDVDELETLEVAQGVALPEMGASSGSIGTSS
SSSSTCSAC
 gene cluster 
30  orf_propep *VSSNTLLALDDLDIEAIHVVEIPGIADSLAAGHSMPETGASACCSIVCSS
CCCSC
 gene cluster 
31  SVEN_5130MSDDIKQGQDADKAFENFDVDELETLEVAQGVALPEMGASSGSIGTSSSS
SSTCSAC
 gene cluster 
32  SVEN_5131MSIDDIKNGDDAAFDNFDVAELETLEVAQGVALPEMGASSGSIGTSSSSS
STCSAC
 gene cluster 
33  SBI_02233MENTSLLDLEQLGDEMFEVVESDTTEDKGGAGSAWAYACCHSASSSCALS

 gene cluster 
34  orf_propep *MEETEFDFDLEDIPSDVFELADRGLTVESLTSGHGLVENGASSPSCGSSC
SSLP
 gene cluster 
35  HMPREF9601_02031MENETLDLDVMELADIIGSASDQDDMAQVMAASCTTTSVSTSSSSSS
 gene cluster 
36  Caci_3697MQIHTTETLEDTSVTALAAEILALESETFEITDYSDASEVMLGSSTSCSS
TSTCSSTTSTTSCSA
 gene cluster 
37  orf_propep *MTNMQRDTMSDLNLDLLSMEIEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSSSS
 gene cluster 
38  Bsph_4019MKKEMHTQEVNTNEFDLEVELLDLDEVSAIPETTASSGSTSCSASSTCGS
TSCCGSC
 gene cluster 
39  Bsph_4020MKKEMNTQTVNAKEFDLEVELLDLDEVSAIPETTASSGSTSCSASSTCGS
TSCCGSC
 gene cluster 
40  Haur_0911MADVKNLIDAEVTAAETELFADELEEHVTNVAAACVSSLGSLSTSGTICT
VSTFCTAAIEAQ
 gene cluster 
41  Haur_0912MSDVKNLIDAEVTAAETELFADELEEHVTNVAAACVSSLGSLSTSGTICT
VSTFCTAAIEAQ
 gene cluster 
42  Haur_0913MSDVKNLIDAEVTAGETELFADELEEHVTNAAAACVSSLGSLSTSGTICT
VSTFCTAAIEAQ
 gene cluster 
43  Haur_0914MSDVKNLIDAEVTAAETELFADELEEHVSNAAAACVSSLGSLSTSGTICT
VSTFCTAGVAEK
 gene cluster 
44  Haur_0915MSDVKNLIDAEVTAAETELFADELEEHVTNVAAACVSSLGSLSTSGTICT
VSTFCTAAIEAQ
 gene cluster 
45  BB14905_21618MEKDLRKKELSANEFDLEVELLDLDEVSAIPETTASSGSTSCSASSTCGS
TSCCGSC
 gene cluster 
46  BB14905_21623MKKEMTTQTVNAKEFDLEVELLDLDEVSAIPETTASSGSTSCSASSTCGS
TSCCGSC
 gene cluster 
47  BB14905_21628MKKEMHTQEVTTKEFDLEVELLDLDEVSAIPETTASSGSTSCSASSTCGS
TSCCGSC
 gene cluster 
48  BCE_G9241_0514MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGSSGCSASSTCGS
SSCCGSC
 gene cluster 
49  BCE_G9241_0515MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGSSGCSASSTCGS
SSCCGSC
 gene cluster 
50  BCE_G9241_0517MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGTSSCSASSTCGS
SSCCGSC
 gene cluster 
51  BCE_G9241_0510MVKSIIKARESGRFYETKYLKGGEEMKEQKELKNEEFELDVEFLDLDEVS
AIPETTASSGTSSCSASSTC GSSSCCGSC
 gene cluster 
52  BCE_G9241_0512MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGTSSCSASSTCGS
SSCCGSC
 gene cluster 
53  HMPREF1034_2454MENETLDLDVMELADIIGSASDQDDMAQVMAASCTTTSVSTSSSSSS
 gene cluster 
54  HMPREF9056_02779MTNSAIDLTLADSDFGVEELPEGNALGCAFSHASASCPASAASASCPACA
ASASTTSC
 gene cluster 
55  SSMG_08024MNEFDTQVEQAFAEDVTVEELGEVAGAGTTNTGGTISSTTCPACIGTAFS
WS
 gene cluster 
56  BC059799_0516MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGTSSCSASSTCGS
SSCCGSC
 gene cluster 
57  BC059799_0517MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGSSGCSASSTCGS
SSCCGSC
 gene cluster 
58  BC059799_0518MKEQKEQKELKNEEFELDVEFLDLDEVSAIPETTASSGSSGCSASSTCGS
SSCCGSC
 gene cluster 
59  BC059799_0519MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGTSSCSASSTCGS
SSCCGSC
 gene cluster 
60  Clocel_3637MNSNLLIEELELNVDSAFEGIDIIELDETMTLSETAASSGVSSCNSCSCC
GSTSCCSIGTINIT
 gene cluster 
61  Clocel_3638MNSNLLIEELELNVDSAFEGIDIIELDETMTLSETAASSGVSSCNSCSCC
GSTSCCSIGTIKIT
 gene cluster 
62  Clocel_3639MNADLLIEELEMNVDSAFEGIDIIELDETMTLSETAASSGVSSCNSCSCC
GSTSCCSIKTISIT
 gene cluster 
63  orf_propep *MTNSSIDLTLADSDFGVEELPEGNALGCAFSSASASCPASAASASCPASA
ASASCPACAASASTTSC
 gene cluster 
64  orf_propep *MTNMQRDTMSDLNLDLLSMEIEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSSSS
 gene cluster 
65  orf_propep *MIACVLPSRTVMILRLLKSCAMKLIFPFVKAYSSQDIISGRQEKSCLK
 gene cluster 
66  tsrAMSNAALEIGVEGLTGLDVDTLEISDYMDETLLDGEDLTVTMIASASCTTC
ICTCSCSS
 gene clusterexperimental 
67  BATR1942_14085MSEKDTSIKTLELYAEELPAQVDLATVAGTASTASSFTTASCPATTASTA
GSASSYG
 gene cluster 
68  BATR1942_14095MEKDKMHELELFAEELPEQVDLATIAASFSSTSSVSTASCPGTTAASAGT
VSCYG
 gene cluster 
69  orf_propep *MTSMHRDAMSGLNLDLLAMEVEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSSSS
 gene cluster 
70  CULC22_01779MTSMHRDAMSGLNLDLLAMEVEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSSS
 gene cluster 
71  HMPREF9176_0877MKDENKLLEELEIDILELDDVEGVPATAATSGSGGSSTCGSTSCSSCSSS
CA
 gene cluster 
72  HMPREF9176_0878MKDENKLLEELEIDILELDDVEGAPATAASSGSGGSSTCGSTSCSSCSSS
CA
 gene cluster 
73  BFZC1_19220MNDNQNFNRNLKDTLYIEEQMDVSEFAGFTTTSSLATGGSFASVGSCASS
VSTGSCISSAGD
 gene cluster 
74  HMPREF9948_1496MMEFSDMISDATERDDVTQIMAASCVETSVSSSSTSSS
 gene cluster 
75  HMPREF9948_1497MENETLDLDVMELADIIGSASDQDDMAQVMAASCTTTSVSTSSSSSS
 gene cluster 
76  getAMGNNEEYFIDVNDLSIDVFDVVEQGGAVTALTADHGMPEVGASTNCFCYI
CCSCSSN
 gene clusterexperimental 
77  Cp3995_1666MTNMQRDTMSDLNLDLLSMEIEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSSSS
 gene cluster 
78  orf_propep *MTSMHRDAMSGLNLDLLAMEVEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSS
 gene cluster 
79  orf_propep *MTSMHRDAMSGLNLDLLAMEVEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSS
 gene cluster 
80  orf_propep *MTSMHRDAMSGLNLDLLAMEVEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSS
 gene cluster 
81  orf_propep *MTSMHRDAMSGLNLDLLAMEVEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSS
 gene cluster 
82  orf_propep *MTSMHRDAMSGLNLDLLAMEVEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSS
 gene cluster 
83  orf_propep *MTSMHRDAMSGLNLDLLAMEVEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSS
 gene cluster 
84  orf_propep *MTSMHRDAMSGLNLDLLAMEVEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSS
 gene cluster 
85  orf_propep *MTNMQRDTMSDLNLDLLSMEIEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSS
 gene cluster 
86  orf_propep *MTNMQRDTMSDLNLDLLSMEIEGLEVNDYVDADDTAFFSMCSSTTSSSSC
ISTSSSSS
 gene cluster 

gene cluster: Biosynthetic gene cluster identified
experimental: Data derived from experimental literature
*  : Newly annotated short orf that was missed in the original genome annotation at GenBank