Home 

Gene Symbol:  
nosD
Organism:  
Streptomyces actuosus ATCC 25421
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5328..6365 [-1], 1038 bp
Product Function:  
dehydratase
Product Locus:  
 ACR48333.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =1.10E-121;  Score=397.7
  
Nucleotide Sequence:1038 bp
>nosD|ThioFinder104 Streptomyces actuosus ATCC 25421
ATGCCCGCCCCTGAGACCGGCCCCTGGCACAGCCTGCACCTGCACCGGTACGCCGGGCAGGACGCGTTCC
TCGTGGACGGGCTGGCCCCCGTGCTCGCCCCGCTGCACGCCTCCGGCGCGCTGGAGAGCTCCTTCTTCCT
GCGGTACTGGCAGGGCGGCCACCACATCCGGCTCCGCCTGCGCCCCGCCGCCCACGACCCCGAGCAGGCC
GCCCGCACCGTGCGCGAGGTCGCCGACCGCCTCGCCGGCCACCTCGCCGCCCATCCCGGCGGCTACGGAG
ACCTCGACCCCGAGGAGTTCCGCGAGGCCCAGCTGACCATGGCCGCACTGGAGTCGGAGGCGACCGGCGA
ACTGCTCCCGCCGGACACCGTGCACCCCGCCCGCTACGAGCCCGAGTACGGCAAGTACGGCGGCCCGGAG
GGTGTCGCCGTCGCCGAGCGGTTCTTCGACCGCAGCAGCGCCGTCGCCCTGTCCGCGCTGCGCGCCATCG
GCGACCGCCCGGCCCGCCGGCTGGGCGCCGCGTTCACCATGACGCTGCGCGGCCTGTGCGCGGCCCGGCT
CTCGCCGCCCGCCATGGCCGGGTTCCTCGCCCACTACTGCGCGGTGTGGTCGCCGTACGTCTTCGACAGC
TTCCTCGACACCTGGCCCGAGCTGCTGGACCAGCGCCGCGGCCCGGCCGCCGCCCACCTGCGGCCGCTGC
TCGCCGCCGCGCAGCCGCCCGACGACCCCTACGGCCGGGCCGTCGGCGAGGCCTGGCAGGCGCTGCACAC
GGCCGCGGACACCGTGCTGCCCGCGGTCACGCTCGGCGGCCCCGACGCGCCGGCGGAGCGGCGCCGCCAG
ATCGTGCTCCTCAGCTATCTGCACACCCACAACAACCGGCTGGGCCTCATCCCGGAGCAGGAGGCCTTCC
TCGGCTACCTCGGCCACCACGTCGTCGCCGACTGCGCGGGCCTCGCCCCGGACGCCGGCCTGCTCGACCG
GGTCCGCGACCACCGCCGGGAACGCCTCGCCGCCCATCTGCCCTCCGGCCAGCACTGA
 Primer design

Protein Sequence:345 a.a.
>NosD|ThioFinder104 Streptomyces actuosus ATCC 25421
MPAPETGPWHSLHLHRYAGQDAFLVDGLAPVLAPLHASGALESSFFLRYWQGGHHIRLRLRPAAHDPEQA
ARTVREVADRLAGHLAAHPGGYGDLDPEEFREAQLTMAALESEATGELLPPDTVHPARYEPEYGKYGGPE
GVAVAERFFDRSSAVALSALRAIGDRPARRLGAAFTMTLRGLCAARLSPPAMAGFLAHYCAVWSPYVFDS
FLDTWPELLDQRRGPAAAHLRPLLAAAQPPDDPYGRAVGEAWQALHTAADTVLPAVTLGGPDAPAERRRQ
IVLLSYLHTHNNRLGLIPEQEAFLGYLGHHVVADCAGLAPDAGLLDRVRDHRRERLAAHLPSGQH