Home 

Gene Symbol:  
nosE
Organism:  
Streptomyces actuosus ATCC 25421
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
6352..9114 [-1], 2763 bp
Product Function:  
dehydratase
Product Locus:  
 ACR48334.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =0;  Score=1124.4
  
Nucleotide Sequence:2763 bp
>nosE|ThioFinder105 Streptomyces actuosus ATCC 25421
TCAGGGGCGGGCATGGGCGTCCTCCGTGGCCTGGGTTCCGGCGGGGGCGGGGGTGCCGAGGGTGTACTCG
ACGAAGAACTCCTCCGCGCCGGAGGTCCGGCCGTCCAGGTCGCCGGCGTGCGGCAGGCACTCCTGGAAGG
TGACGGTGGCGTCCGGGCCGGCCTCGGCGAGCCGGCGGGCGAAGACCTGGAGGAGGAAGGGGTTGCGGGC
GTCGAGGTAGTGCGGTTTGTGCAGCCGGGCGGTGCGCGCCTCCAGCGCCCACTGCCGGGTCTCCGCCAGC
AGGTCGCGCTCGCCGGCGGGCACGGGCGGGGGCGTGGTCAGCCGGAAGAAGGTGTGCCGGGGGATGCCGC
GCTGCCCGAGCCAGCGGTCGAACGAGGCGAGGGCCGCCGCCTCCTGCCGTTCCAGGCCGTCGGTGTCCGG
GACGTCCGCCGCGGGCAGCCGCCAGGAGGCCCGGTCGAGGACGAGGTCGCCGAGCAGTACCCGGGGCAGC
GACCGGTGGGTGGCGGGGACGCCGGTGCGGCCGGCGGCCCGGCCCGCTTCCGCGTCGGCCCGGTCGAGCT
GGTCCCACAGTCCGCCGCGGTAGGTGCGGGTGGGGGCGAAGGCGCACAGCAGCCGGTACAGGCCGGGTGC
GGCGGCCGGGTAGAGGAAGTTGAGCGGTACGAGGTCCAGGGGCTGCCCGTCGCGGGTGCTGACCAGGGCC
AGGGTGCGGCGGGCCGGGTCGGCGCGGACGGCCAGGTCGGCGAGGGTCAGGGTGTGCTCGTCGGCGGCGC
GCGGCACCGAGCCGGGGTAGACCAGCTCGTACGGGCTGAGCCGGGGGTGCAGGTTGAAGTTGAGGCCGAG
GACGGCCGTGATGTCGCACTGGCGGGGCGTCGTGCGGGCGATGTGGCCGCGCAGCGCCTCGGTGAGGCTC
CACTCGTGCGGCCCGTCCGGCTCCAGCAGGTCGCAGAACCGGGAGAAGAACACGCCGTGCCCGGTGGTGA
CGCCGTTGACGACGGCGTACGGCCGCTCGGGTTCCGCGGTGAACTGCATCCGGTAGGCGGTGGACCGCCA
GGGGGTCACCTCGGCGGGCAGCCGGTCGGCGAAGGCGCGCAGCCGCTCGGCGTCCAGGCGCAGCGCGCCG
GTGTGTGCGCTGTCATGGGCGCGCAGTTCGGTGCGGAGGAGGTCGGCGAAGTCGGCGCGCAGCCGGCGGA
TGCGGTCGCTGTGCGGGTCGCCGACGCCGGAGGCCACGGCACTGGCCTCGGCGGGCGGCAGCGCGGCGAA
CCGGCGGTAGAACTCGATGAACGGGACGTCGCCGTCGCCGTCCGCCGCGCCGAAGTGCCGGGCGAAGAAG
GCATACAGGCCCGCCTTCTCCACGCTCGCGTCGTCCAGCACCGGGACGATCCGCTGGAACAGCTCCAGGG
CCCAGCGGTTGGCGTGCAGCAGGTCCGGGTGCCAGCTGTGGGCGGGTTCGCGGGTGCCGACGTCCTCGTA
GACGACGGAGCGCATGGCCTCGGGGGCGGGGGCGCGGCAGCCGACGGCCTCGACGAACACGGCGACCTGT
TCGCGGATCTCGGCCAGCAGCGCGGCCCGCCGCCGCACGGGGGCGGCCGGGAAGGCGTCCTCGGCGGCCT
GGAGCCGTTCGAAGACGACGGCGCAGCGGCCGGCCTGGTCGGTGTCGAGGGTGCGCAGCCGCTGGGCGAC
GGCGAGCGCGGGGCGCGGGTGCTGGTCGGGGATGCCGAGCCCGCGTTCGCAGATCCCGGCGCGGACCAGC
TTGTCCAGGGCGGTCGCCGCGGCCTGCGGGGAGAGTCCGGCGGCGGCCAGCCTCTCGCGCAGCTCGCGCT
CGGGCAGCCCGCCGTCGGCGAGCAGGGACCGCAGCAGGCGCAGCAGGCCGGTGTCGCGGGCGGTCACCAC
CTGGGCGGTGCCGTAGGCCGCCTCGGGGGCGCCGTCCGGGGCCCGCCGTACGCACAGGGCCTGTTCCTCC
CGGACGAGCAGGGAGTGGTTGAGCCGGATCCGCATCAGCTCGTCGGCGCGGTCCAGGCGGTGCAGTTCGT
ACGTCATCCAGGACAGCAGTCCCGCGCTGAGCCGGGCCTGGACGGGGCGGGCCGGAGGGCGGTCGGCCGG
TGCCGTGCCGTCGCCGGCGGGCGTCCAGGGGGCGGCGCCGATCTCGGTGAAGGAGGCGAACGGCGACGGC
TTGAGGGCGACCCGGTAGGCGAAGCTGGTCAGCGTGTTCTCGGCGCGGCGCCGCTTGCTGGGCTTGCGGC
GCGCGGAGAACGGGTCGGCGGCCCACTCGGTGACGGTCCGCCAGGTCCGCTCGTCGGATAGCTGGAGGCC
GCGCTGGAAGAACTCCCCCGTCGCGATGGCCGCCAACGCCCTTCGACCCGCGTCGAGTTCGGCGGCGAGG
GCCGCTTCGGCCTCCTTGTGCAGCCGGTTGCCCTCGGCGCGGTGCCGCAGCCAGTCCTCCAGCAGTTCCC
GGCTCGCCGGGTCGAGCAGGCGGGCGGCGTCGGGGACGCCGGGGACGCGGTCGTTGTGGATGTCGCGCCG
CAGCCGCAGCAGTTCGTGGCGCCGGTCGGCGGGCAGCTCCGGCACGGCCGCGTGCAGCGCGTCCTCCAGG
CGCCCGCGCAGCTCCTCCCGCCGCTGCCGGGTCTCCTCGGCCTCCGCGAGCAGCGCCCAGGTGCGCGCCG
GGGTCAGCGCGGCCAGCTCGGACGGGCCGAGCGTGCCGCGGCGGTAGAGGTAGTAGGGGCTGAACCCGTC
GGGCGCGCCGGCAGCGTCGGGCGCGCCGGGCAC
 Primer design

Protein Sequence:920 a.a.
>NosE|ThioFinder105 Streptomyces actuosus ATCC 25421
MPGAPDAAGAPDGFSPYYLYRRGTLGPSELAALTPARTWALLAEAEETRQRREELRGRLEDALHAAVPEL
PADRRHELLRLRRDIHNDRVPGVPDAARLLDPASRELLEDWLRHRAEGNRLHKEAEAALAAELDAGRRAL
AAIATGEFFQRGLQLSDERTWRTVTEWAADPFSARRKPSKRRRAENTLTSFAYRVALKPSPFASFTEIGA
APWTPAGDGTAPADRPPARPVQARLSAGLLSWMTYELHRLDRADELMRIRLNHSLLVREEQALCVRRAPD
GAPEAAYGTAQVVTARDTGLLRLLRSLLADGGLPERELRERLAAAGLSPQAAATALDKLVRAGICERGLG
IPDQHPRPALAVAQRLRTLDTDQAGRCAVVFERLQAAEDAFPAAPVRRRAALLAEIREQVAVFVEAVGCR
APAPEAMRSVVYEDVGTREPAHSWHPDLLHANRWALELFQRIVPVLDDASVEKAGLYAFFARHFGAADGD
GDVPFIEFYRRFAALPPAEASAVASGVGDPHSDRIRRLRADFADLLRTELRAHDSAHTGALRLDAERLRA
FADRLPAEVTPWRSTAYRMQFTAEPERPYAVVNGVTTGHGVFFSRFCDLLEPDGPHEWSLTEALRGHIAR
TTPRQCDITAVLGLNFNLHPRLSPYELVYPGSVPRAADEHTLTLADLAVRADPARRTLALVSTRDGQPLD
LVPLNFLYPAAAPGLYRLLCAFAPTRTYRGGLWDQLDRADAEAGRAAGRTGVPATHRSLPRVLLGDLVLD
RASWRLPAADVPDTDGLERQEAAALASFDRWLGQRGIPRHTFFRLTTPPPVPAGERDLLAETRQWALEAR
TARLHKPHYLDARNPFLLQVFARRLAEAGPDATVTFQECLPHAGDLDGRTSGAEEFFVEYTLGTPAPAGT
QATEDAHARP