Home 

Gene Symbol:  
nosF
Organism:  
Streptomyces actuosus ATCC 25421
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
9129..10778 [-1], 1650 bp
Product Function:  
NADH oxidase
Product Locus:  
 ACR48335.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =4.20E-193;  Score=633.8
  
Nucleotide Sequence:1650 bp
>nosF|ThioFinder106 Streptomyces actuosus ATCC 25421
ATGACGACCGACGAGGCGTACACCTACACCACCGGGCTGCGGCTCGACCCGCGCTCCGCCAACCCGGACG
GCTGGCGGGTGGACTGGGCCGACGGGCCCTGGCCGGTGAAGGTCTACAGCGGAGCGCGGCGGCTGCCGCT
GCGGCCCGACGGACCGCCGCCGCTCGCGGCCCTGCACCGGCTCCTGCACGGCGGCTTCGCCGTCAGCCGG
ATCCGCACCGACCCGTCCGGCGGCATCGCCGCCACCCCGGCCGACCCGCGTCCGCACCACGGGCCCGAGG
TGCAGTTGCGCCGGCCCGTCCCGTCGGGCGGGGCGATGTACCCGACCGAGGTGTACGCCGCCCTCACCGC
GACCGGGCAGGTCTGCCACTACGACCCCTACCGGCACGAGCTGACCGTGCTGGCCGGCGGCGACGCGGCG
GCCCGGCTGCGCGCCGCGCTGCACCTGCCGACGGAGGCGGCGCCCGCGGCGGTGCTCGTCCTGACCAGCC
GCTTCTGGAAGAACTTCTACAAGTACGGCGACTTCGCGACCCGCCTCGGCCTGGTCGACGCCGGGGTCGC
CCTCGGCCGCGCCGCCCGCCTCGCGCGGGCCGAGTGGGAGCACGCGGAGGTGCGGACGGTCTTCGACGAC
GAGGCCGTGCACGCCTGCCTCGGCCTCGACGGGGAGGAGGAGAACGCGTGGGCGGCGGTGACGCTCGGAC
CGTACCTCCCGTACAGGGCGGACACCGGCGGACCCGACGCCCCGCCCCGCCCCGCCCTGCTGGAGCGCTC
CCGGACGGTACGGCGCTCCGACCGCTTCACCGCCTTCCAGCGCGCGGCCCGCGAGGACACGAGCACCGCC
GCGCCCGCCCGGCCGCCCGAGGACGCCGTACCGGCCACCGCGCCCGGCCCCGTGCCCGGGGACGCCGGAC
CGGCCGCCGCGCCCGGCCCCGTGCACGAGGACGCCGTGTCGGCCGCCGCGCCCCGCCCCGTGCCCGGGGA
CGCCGTGCCGGTCGGCCCGGTGCCGCTGCCCGCCCCCCGCGCCCTCGATCTCCTCGCCGCCGAGACCGCC
GCGCGGCGGTTCTCGCGGGGGCGCTTGTTCACCGGGGCCGAGGCCGACGGGGAGGCCCTCGCGGGGGTGC
TGGGGCAGGCGGCCGAGGCGCTGCGGGCGCTGGCCGGAGCCGGGGCGGACGGGCCGGCCGGGTGGGCCGC
GCGGACCCGCCTGTACTGCGCCGTCCACCGGGTGCGCGGCGTGCCGCCGGGCTGGTACCGGTACGCGCAC
GAGCTGGGCGCGCTGCTGCCCGTGGGGGAGGGGACCGGGCCCGGCAGCGCGCGCCGGGTGCAGGAGGCGC
TGTTCGCCGCCTCTTTCAACGCCGAGCTGGCCGCCTTCACCGTCCACCCGGTGACCCCGGCCGACTGGCG
GCCGGCGGGCGGCCCGCGCGCCTACCGCGCGCAGCAGCTCGCCGTGGGCGCGGCGATCGAGGCGGTGACG
CTGGCCGCGGCCGCCGAGGGCCTCAGCGGCCACGCCGTCCTCGGGTTCGACGTGACCCGGATCGACACGG
CGTACGGCCTCGACGGCGGCGCGGACACGGACGGCGGGACCCAGGCGCAGATCTGCGTCGGCGCCGTACG
CCCCGACCCGAACTGGGAGATTGCGGTGATGCCACGGTGA
 Primer design

Protein Sequence:549 a.a.
>NosF|ThioFinder106 Streptomyces actuosus ATCC 25421
MTTDEAYTYTTGLRLDPRSANPDGWRVDWADGPWPVKVYSGARRLPLRPDGPPPLAALHRLLHGGFAVSR
IRTDPSGGIAATPADPRPHHGPEVQLRRPVPSGGAMYPTEVYAALTATGQVCHYDPYRHELTVLAGGDAA
ARLRAALHLPTEAAPAAVLVLTSRFWKNFYKYGDFATRLGLVDAGVALGRAARLARAEWEHAEVRTVFDD
EAVHACLGLDGEEENAWAAVTLGPYLPYRADTGGPDAPPRPALLERSRTVRRSDRFTAFQRAAREDTSTA
APARPPEDAVPATAPGPVPGDAGPAAAPGPVHEDAVSAAAPRPVPGDAVPVGPVPLPAPRALDLLAAETA
ARRFSRGRLFTGAEADGEALAGVLGQAAEALRALAGAGADGPAGWAARTRLYCAVHRVRGVPPGWYRYAH
ELGALLPVGEGTGPGSARRVQEALFAASFNAELAAFTVHPVTPADWRPAGGPRAYRAQQLAVGAAIEAVT
LAAAAEGLSGHAVLGFDVTRIDTAYGLDGGADTDGGTQAQICVGAVRPDPNWEIAVMPR