Home 

Gene Symbol:  
nosG
Organism:  
Streptomyces actuosus ATCC 25421
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
10830..12800 [-1], 1971 bp
Product Function:  
putative cyclodehydratase
Product Locus:  
 ACR48336.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =4.60E-260;  Score=856.1
  
Nucleotide Sequence:1971 bp
>nosG|ThioFinder107 Streptomyces actuosus ATCC 25421
ATGAGTACGGCGACCACCCCGCAGCCCCGCACCGGGCCGGCCGGGCCGCCGGTCGTCGTCGGGCGGGGCG
TGCTCGCCGAGCATCTGGTCCGGCGCCTCGGCCGCGACGACACCCCCGACCCGGACGGCGGTGCACGCTT
CGGCCGGTCCTCCGGGGCGACCGTGCTCGTCGCCGGGCTCGACGGGCTCGGCGAGTTCCAGGACACCGTC
GTCGACTGCCTGGCCACCGGACGCTCCCTGCTCTTCGTCGGCAGCTGGCGCTCGCTCGTCTACATCGGCC
CCGTCTGGCGCCCCGGCACCCAGGGCTGCCCGCGCTGCCTGGTGACCCGGACCGCCAACTCGCCCTTCGG
GCCCGGCCTGGAGGGCGACAGCCTCGCCGAGTCCTGGCCGCACGGCGCGGACGTCCGCATCTGGGGACCC
GGCGTGCTGCGGCTGGTCGAGGAGTACGTCCGCGCCCGGCTCGCGTCCTGCAAGGGCCCGGCCGGCCCGG
CCGACGGCCGCGTCCTCGTCCTCGACGGCGCCGCCGGCACGGTCGAGCAGCAGACCCTGCTGCCGGACTC
CGGCTGCCCGAACTGCGGCAGCCTCCGCGAGGACACCGTGCCCGCGCTGACCCCCGCCGCCGTCCCGCTC
ACCAAGCTCACCCCGGCCACCCTGCGCACCGGACGGCTGCCCGCGGACGCCGTCCGCGGCGACTACCTCT
ACGCCGGCCTCGGCCTGTTCAAGGAGCTGCGGCAGGACCTGCAGAGCCCCTTCGGGGCCTGCTCGGTGGA
GCTGCCGCCGCGCTGGGGCCGCCGCGAGCCCGCCATCGGCCGCGCCGCCGACTACGCCACCAGCCGCACC
GTCGCCGTCCTGGAGGGCCTGGAGCGCTACGCCGGCCTGCACCGCGGCGGCACCCTGCCCCCCGTGCGGG
CCCGCTACGCGGACGTGGCCGACCAGGCCCTGTACCCGCCGGACCTGGGCACCCACCCGGAGGAGAGCTA
CGCCTCCGAAGGCTTCCGGTACCGGCCCTTCGACCCCGGCACCGAGATCGACTGGGTGGGCGCGTACTCC
TTCCGCCGCGACGGACGCGTCCTCGTCCCGGAGCGCGCCGCGTTCTGGGGACCGCGCCACGACGACGAGA
TCTCCTTCTTCTACGACACCTCGAACGGCTGCGCCCTCGGCAACAGCGTCGAGGAGGCCGTCCTGCACGG
CCTGCGCGAACTCGCCGAGCGGGACGCCTTCCTGCTCACCTGGTACCGCGAACTCGACGTCCCAGAGGTC
GCCCTCGACGGCACCTCGCCCGCCCTGGACCACCTGCTGGCCAAGTCCCGCCTCTTCACCGGCTTCGACT
TCCGCTGCTTCGACGCCACGATGGAGTACGGCGTCCCGGCGCTGCTGCTCACCGCCGAGAACGACAGCGG
CGACGGGCCCCGGCTCTTCGCGGGCTGCGGCGCGCACCCCGACCCCGTCCAGGCCGTCACCGGCGCCCTG
CACGAGCTGGTGGGCACGGTCCTCGCCACCCGGGACGCCTACGAGCGCCGCCGCCCCGACGCGCTGCGCA
TGCTGGCCGACCCGTTCCTCATCCGCCGCATGGAGGACCACTCCACGGTCGGCGCGCTGCCCGAGGCCCG
CGACCGCTTCTCCTTCCTCCTCGACCGGCCCCGCACCGGCGCCCCCGTCCCGCTCGGCCGGGTCCGCTCG
ACGCTCCGCACGCAGGACGCCGACCTGCGGGCCGACCTGTACGCGGCCGTCTCCGGCGTCCTCGACTGCG
GCCTCGACGTCCTGGTCGTCGACCAGACCATGCCCGAGCTGCGCCGCAACGGCCTGCACTGCGTCCGGGT
GCTGGTGCCGGGCCTGATCCCGATGACCTTCGGCCACCGCAACCGCCGTACCTGCGGCCTGCCCCGGCTC
ACGGAGGGCACCACCCTGCCCTACCGCAGCCTGCTGGCCCCCGGCCGGGAGATCGGCGCCGTCCCGCACC
CCTTCCCGTAG
 Primer design

Protein Sequence:656 a.a.
>NosG|ThioFinder107 Streptomyces actuosus ATCC 25421
MSTATTPQPRTGPAGPPVVVGRGVLAEHLVRRLGRDDTPDPDGGARFGRSSGATVLVAGLDGLGEFQDTV
VDCLATGRSLLFVGSWRSLVYIGPVWRPGTQGCPRCLVTRTANSPFGPGLEGDSLAESWPHGADVRIWGP
GVLRLVEEYVRARLASCKGPAGPADGRVLVLDGAAGTVEQQTLLPDSGCPNCGSLREDTVPALTPAAVPL
TKLTPATLRTGRLPADAVRGDYLYAGLGLFKELRQDLQSPFGACSVELPPRWGRREPAIGRAADYATSRT
VAVLEGLERYAGLHRGGTLPPVRARYADVADQALYPPDLGTHPEESYASEGFRYRPFDPGTEIDWVGAYS
FRRDGRVLVPERAAFWGPRHDDEISFFYDTSNGCALGNSVEEAVLHGLRELAERDAFLLTWYRELDVPEV
ALDGTSPALDHLLAKSRLFTGFDFRCFDATMEYGVPALLLTAENDSGDGPRLFAGCGAHPDPVQAVTGAL
HELVGTVLATRDAYERRRPDALRMLADPFLIRRMEDHSTVGALPEARDRFSFLLDRPRTGAPVPLGRVRS
TLRTQDADLRADLYAAVSGVLDCGLDVLVVDQTMPELRRNGLHCVRVLVPGLIPMTFGHRNRRTCGLPRL
TEGTTLPYRSLLAPGREIGAVPHPFP