Home 

Gene Symbol:  
nosH
Organism:  
Streptomyces actuosus ATCC 25421
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
12797..14761 [-1], 1965 bp
Product Function:  
hypothetical protein
Product Locus:  
 ACR48337.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =8.30E-218;  Score=716.3
  
Nucleotide Sequence:1965 bp
>nosH|ThioFinder108 Streptomyces actuosus ATCC 25421
ATGACAGACGTGGCAGCAGACAGGGCACAGCCGGCCGGCCCGGCCGCCGACCCGCTGACCGACACCCTCA
CCCGCACCTACCGGCTCCGCGCCGACGCCTTCTACGTCCGCCAGCAGGACGGCGTCTGGCTCGGCAACAA
CACCGGCTCCTTCTCCGTCCGCGGCCAGGGCGCCTACCAGCTGGTCAGCTCCCTCTTCGCCGGGCTGGAC
GGCGAACGCACCCTCCAGGACCTCTACGGCGACCTGCCCGACCGGGCCCGCCGGTCCGTGCTGGGGCTGG
TGCGGGCCATGCTGCGCAACGGCTTCATCAAGGAGGTCGCCCACCCCGTCGAGCCGGTGCCCGGCTGGAT
GCGCGAGCGGTACGCCACCCATCTGGCGTTCCTCGAACACCACGCCGACCGCCCGGTCACCCGCCTCCAG
CAGGTCCGCACGGCACGCGTGGTGTGCGCGGGCCGCGGCACCGCGCTGCACGCCCTGCTGGACGCGCTGC
GCGAGTTCGGCATCGCCCGGCTCGACGTGGTCCCGGACGGCGACGACGACCTGACCGCCGTACAGCAGGT
GCTGAAGGAGACCGCCGCGGCGGATCCCGGGGCGCGCTGGCGGCTGCGCGACCCGCTCGCGGCGGACGGA
CCGGCCGCGCTGGCCGGACACCCCGACGTCGAGGGCGCCGACGCCGTCCTGCTCGCCTACGACAGCGCCG
ACGCCGCCGCGCTGGCCCGCTCCCAGCACGCGCTGTGGCGCGACGGTGTGACCGTCGGGGTCCTCGCCCG
GTGCGGCGACTTCGTCACCGCGCTCGAACCCGGGCTGGGCACCCCGTACTGCTGGGAGTGCGTGCACCGC
TCGATCGCCGTCCGGGCCACCGGCGACACCGCGGGCCTCGCCCCGGCGGTCGCCCCGGCCGCGGTCGGCG
CGCTGCGGGTCGCGCAGCACACCTTCGCCCGGCTGGCCGGGGTCCGGCCGCCCGGGGACAAGCCGGTGAC
CACCGTCGAACCCCTCGTCCCCGCGGTGCGCGGCCACGCCGCCCGGCGGCACCCGCGCTGCCCGCACCAC
GAGCCCGCCGTACCGCGGCGGCTGCCGCCCGCCGGGGCCGCCGCACCCGAGGACGCCGTGCGGCCCGACA
TCCCGCGCTCCGAGGACCCGCCCGAGCGGGTGCGGATCTCCGACCGGATCGTGGCGGCCTGCGCCGCCCT
GACGGACGCGGTCACCGGCCCGCTGCTCGCGCTCGGCGAGGAGGACCTGGCCCAGCTGCCGCTGTCGGCC
AGTGCCTGCCAGGTCGCCGACCCGGACGGCGGCGCCGACGCGCCCGCCGCCCTCGGCGTGGTGTGCCGGG
CGCTGTCCCCGCGCGAGGCCCGCAACCAGGTCGTGCTGTGCGCGGTGGAGTCGCTGGCCGGCCGCCTCAC
CGCAGGGGACGCGCGCTACGGCGCGGTCGGCGCCGGCTGGTCCCTGGGCGAGGCCCGGCTGCGCGCCCGG
CTGCACGCGGCGCTCGGCCGGCCCACGCCGGACCTCCACTGGGCTCCGGCGCCGGAGGAGCCGCCGCCCG
GCGACACCGCGGCAGGCTACCTCGCCGGGGTGCTGGCCGCCGAGGGCACGCCCTGGACCGCCACCGCCGC
CGAGGAGCTGCCCGACGGCGTCGTCCGCGCCCATGTGCGCACCCGCGACGGCGCGGTCACCGCGGGCGTG
GGCACCGACCGGGAACGGGCGGTGGGACACGCCCTCCTCAACGCGGTGGCGCGCGTCCTGCCGCTGCCCG
GGAACGCCCAGGAGGCCACCGCCTTCCTGGCCCCGGCCACCGCGACCTGGACCGCCGCGCCCACCGCCGA
AGGCGAACGCGAGATCACCGACCTGCTGCCCTTCCTCACCGACACCGACACCGGCACCGGCACCGGCACC
GGCACCGGCAGCGGGGGAGAGGCCGGTGCCCGCGTCCGCGTCGTGGCCCTGCCCGTGTCCGAGGAGGCGT
CATGA
 Primer design

Protein Sequence:654 a.a.
>NosH|ThioFinder108 Streptomyces actuosus ATCC 25421
MTDVAADRAQPAGPAADPLTDTLTRTYRLRADAFYVRQQDGVWLGNNTGSFSVRGQGAYQLVSSLFAGLD
GERTLQDLYGDLPDRARRSVLGLVRAMLRNGFIKEVAHPVEPVPGWMRERYATHLAFLEHHADRPVTRLQ
QVRTARVVCAGRGTALHALLDALREFGIARLDVVPDGDDDLTAVQQVLKETAAADPGARWRLRDPLAADG
PAALAGHPDVEGADAVLLAYDSADAAALARSQHALWRDGVTVGVLARCGDFVTALEPGLGTPYCWECVHR
SIAVRATGDTAGLAPAVAPAAVGALRVAQHTFARLAGVRPPGDKPVTTVEPLVPAVRGHAARRHPRCPHH
EPAVPRRLPPAGAAAPEDAVRPDIPRSEDPPERVRISDRIVAACAALTDAVTGPLLALGEEDLAQLPLSA
SACQVADPDGGADAPAALGVVCRALSPREARNQVVLCAVESLAGRLTAGDARYGAVGAGWSLGEARLRAR
LHAALGRPTPDLHWAPAPEEPPPGDTAAGYLAGVLAAEGTPWTATAAEELPDGVVRAHVRTRDGAVTAGV
GTDRERAVGHALLNAVARVLPLPGNAQEATAFLAPATATWTAAPTAEGEREITDLLPFLTDTDTGTGTGT
GTGSGGEAGARVRVVALPVSEEAS