Home 

Gene Symbol:  
nosO
Organism:  
Streptomyces actuosus ATCC 25421
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
20075..21187 [1], 1113 bp
Product Function:  
hypothetical protein
Product Locus:  
 ACR48344.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =1.40E-124;  Score=405.3
  
Nucleotide Sequence:1113 bp
>nosO|ThioFinder115 Streptomyces actuosus ATCC 25421
GTGACCTCGGGACCGGGGCAGGCCCCGGCCGAGGCGGCACACGCAGCCGGGGCGGCCTGGCTGGAGATCG
GGCTCGACGCCCCCGCCGACGCCGTACCCGCCCTGGTCGCCGGTGTCGTGCGGCCGCTGCTGCGGGAGCC
CGCGGAGCCGGGGGCCGAGCCCGTGCCCGGGTTCTTCCTGCGGGGCGTCGGCGCGGCCCAGCCCGCCCTG
GTCGTCCAGCTGGAGGTGACCCCCGGCACGGACCTCGCCGAGCCGTACGCCGCCCGGGCCCGCGCGCTCG
CCGCCGGGCTGGGCCTCCCCGTGCAGGTCGCGGCCGGCCGGGCGACGCTCGTCCCGCTCGCCGGCTCGGT
CTTCGCGGGGGCGGCCCTCGGCCCGGTGACCCGCGCCGCGCTGGCCGCCGTATGCCCCGCGCTGCTCACC
GCCACCGAGGCCGCGGAACAGGGCAGGCCCGCCCTGCTGGCCAGTGCCGCCGAACTCATGTCCGCGCATC
TGCGCGCGGTCAGCGTCTCCGCGGCCCCCGGCCCCCGCCAGTGGGAGGAACTGCGCGAGGGCGTGCCGCT
CGGCTTCCTCAGCTACCGCTCGCACGCGGAGGCGTTCCTGGCCTCCAGCCGCGACCCGAAGGCCGCGCAG
GCGATGATGGACGCGAAGTACACCCGCGCCGCGGCCACCCTGGAGCGCCTGGTCGACGGCGTCCTCACCC
AGTGCGAGGAGCGCGGCCCGGTGGTCTCCCTGCCGGCGCGGCAGTGGTACGAGGCGATGCGCGCCGCCAA
GCCCGCGGTGACCGAGCTGTTCCGCGCCGGAACCGACCTCGCCCTGGACACCGAGGAGCAGCCCCCGGAC
ACCGGCCCGGACGGCAAGGGCCTGTCCGAAAGCGCGTTCCACCGCATTGTCGAGGGCTCCGACGGGCTGC
GTGACTTCCTCGACCGCGACCCGTCCTTTCTGGCCACCCGACTGCTGACCAGCCTGCTCTACCTTTCCCT
GAGCAGCGTCGGCATCGCCCTGGCGGAACGGTATTTCCTCTGCTACGCGGTGAGCCGCGCCTGTGAGTCG
ATCTTCGACACCGACGCCCTCACCGTCCTGTCCGGTCTGGCCCGGACCTCCCTGGCGTCCTGA
 Primer design

Protein Sequence:370 a.a.
>NosO|ThioFinder115 Streptomyces actuosus ATCC 25421
MTSGPGQAPAEAAHAAGAAWLEIGLDAPADAVPALVAGVVRPLLREPAEPGAEPVPGFFLRGVGAAQPAL
VVQLEVTPGTDLAEPYAARARALAAGLGLPVQVAAGRATLVPLAGSVFAGAALGPVTRAALAAVCPALLT
ATEAAEQGRPALLASAAELMSAHLRAVSVSAAPGPRQWEELREGVPLGFLSYRSHAEAFLASSRDPKAAQ
AMMDAKYTRAAATLERLVDGVLTQCEERGPVVSLPARQWYEAMRAAKPAVTELFRAGTDLALDTEEQPPD
TGPDGKGLSESAFHRIVEGSDGLRDFLDRDPSFLATRLLTSLLYLSLSSVGIALAERYFLCYAVSRACES
IFDTDALTVLSGLARTSLAS