Home 

Gene Symbol:  
cltE
Organism:  
Streptomyces hygroscopicus 10-22
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
10929..13556 [-1], 2628 bp
Product Function:  
lantibiotic dehydratase domain protein
Product Locus:  
 ACS50129.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =4.40E-284;  Score=936.1
  
Nucleotide Sequence:2628 bp
>cltE|ThioFinder208 Streptomyces hygroscopicus 10-22
TCAAGCGGGCCGCTGTCGTTCTCCGGCATCCTGTCCTCCGTTGATCTCGATCAGAAACTCGGTCACCCGG
GGTCCGCTGTCCCCGTAGCCGGGCATGCCGTCCGGGCCGGGCAGTGCCTCCTGGAGGAACAGCACCTGCC
CGTCGCCGGCCACCGCCCGTTCGAACACGCCGGCCAGCAGCAGGTTCGCGAAGTCGACGTAGAGCGGCTT
GCGCGACTTGATCCGCCACACGCTGCCCCCGACCACGGAGGCCGGGTCCAGGGCGCGTACGAAGCAGCGG
CGCGGGATGCCGTGCTCGCGCAGCCAGCCGGCCAGTCGCAGCAGGTGCGCCCGGTCGCTCGCGCCCTTCT
CGCGGACCGGAACGGCGGACGCCGGGAACACCCACTGACGGCGGCTGACCGTGGTCGCGCCGACCGTCAC
ACGGGGTTCGGCCAGCACGCCGCCCACCTCGGCCAGGGACGGGTCCCCGAACATCCGGCGGCCCGGGATG
AGCAGGTTGGACGTCGCTCCGAACACCTGGAGCAGCAGCCGGATCGCGGGTGGGAGCCACAGCTCCGCGA
TGAGGTTGGGATGCACCGGGCGCACCTCGGTGTCGCGACCGCGCGACCACAGGACGAGCAGGCCCCGCGC
GGGATCGTGGCGCACCAGCAGGTCCGACAGCGGAATGCGGTGCTCGGCCGCGCGCTCGCTGTGCCCTTCC
GGGTAGTCGATCTCGGCGGCGACGGCGGACCGCCGTAGCCCCACGTTGCTGCCGAAGTGCCGGCAGGTGT
CCGCGACGATCACTGCGTCGTCCGGTGCGGCTGTCTTCGCCCGGGCCTCGGTACCGGCCTGCGTCAGCAG
GCGGCTGATGCGGTCGCGCCCTCGGCCGTGCCCGGAGTTGACCGCGTTGACCACGAACCGGGCGTCCGGC
CCGTCGAGCGGCTGCCCGTAGAACGCCACGGAGTCCGGCGCCCGCATCCAGCGCGGCCAGCCGTCGGCCA
GATCGGCCAGCCGCGCCGGGTCCAGCCGCACCACGCCGTCCTCGTCGGCGTGGACCGGTGCGGCTAGCGC
GCACAGGTCGGCCCGTCGGGCGGCGAGTTCACGGATGCGGGGGAGGCGGTGGTCCAGCAGGGACGCGTAG
CCGTGGGTCGCGATGGACAGCAGGCCTGGCAGCTCCGGGTCCTCGCGCAGCCACTCCTGCACCGTGCGGT
GGAAGGTCAGCAGGGGCATGCTGGCACCAGTGCCCACGCGTTCGGCGAAGGTGTCTGCGAGGGCCACCCG
GCCGGGCAGCGCCGGGTCCAGTACCGCGTAGCAGCGGCGGACGGTGTCGAGGTCCCGCAGGACCGGCTCC
CAGTCCTGCCGGACCGGGCCCGCCAGGGGCTCCGCCAGCAACGCGTTCTCGATGACGCTGTTCTTGGCGG
GCAGCTGGATCTGCTCGGGCCCGGCCAGGTCCCGTACGCGGCGCAGCACCTCCTCGATCGCCGTGCCGCA
CCGCAGCCGGTCCGCCGCGTCCGGCAGCGTCGGGTACCGCGCCACCAGGGCCGCCAGCGCGTCGACCTCA
CCGACAAGCGCCGCCGTGTCGGGGCCCGCGCCGGCCAGCCAGTCTCGCAGGGCGGCGAGCGGGTCCAGCG
CCTGGTCGGCGAAGGGACGCTCGGCCTCCAGCAGTCCCAGTTCCACCAGTCGGCCCAGGTACGTGTCGGC
GGCGTCCACGCCGTTCCCGGTGCGCGTCGCGATCTCGCGCGCGGCGTCCGCACGGACCCGCCCGGCCTCG
CCGACCGCGGCCACACAGGCCGCGACCGCGGCTCCCGCCGGCAGCCTCCGCAACGGCTCCTCCGGCCCCG
TGCCGAGGAACTCCCAGCGCCCGTCCGCCAGATGGGCGCTGGGGTTGAGACGCAGCCGCATCCGGGCGGC
CAGCACGGGGCGCAGGCTCAGCTGCCGTACCACTTGCTGCACCACCCACACGTTGATCTCCGCGACCGTC
ACCACGGCGAGTCCCGGGGCGGGCGCGGGAGCGGGGCGCGCGTCCGGCTCCCGCCAGACACCGAGACCGC
TGACTGTGAAGGTGCTGAAGGGGCTGGTCTTCATGGTGACCCGGGCCAGGTACTTCGCCAGGCGCAGGGC
CAGCGAGTGGTCCGGCACCGCCTCGTCCGGACGCGCCAGCCACTTGCGGACCTGCCGGTAGAGAACCGGA
CTGCTGAGCACCAGGCCGTGCTGGAAGCCCGGGTCGGCGACCGCCTTGCGCAGCAGCAGGTGCTGCTCGG
CCGTCCGGTGCGCCACCAGCTCGTCCAGTCGGGCGGTGGCCCGCTCATGTTCCGCGAGCAGTTCCGTCCA
GGACCGCACGCCGGCGGTCACGGCGGGCGGCAGCGACGCCCTTACCTCGTCGTTCCAGTACCGGTCGGTC
AGGGCGCGCCGGTTGTGGACGGCCCGGCGCAGCGCCACCAGCCGGGACTTGCCTGTCGTGGCCTGCCCGA
TCAGCCCGTACAGCGCGTCGGACAGTCCGGCCTCCGCGGCGCCGAGCGCCCGCTCGCCGTCCAGGACCGT
CCCGACCTGGTTCCACAGCTCCGGTGAGCTCATGTCGTCGAGCAGCGGTACCGGCAGGCCGCCGACGCGC
ACGCCGAAGACGTCCGGGGTGGTGTGGTTCTCGGTCAT
 Primer design

Protein Sequence:875 a.a.
>CltE|ThioFinder208 Streptomyces hygroscopicus 10-22
MTENHTTPDVFGVRVGGLPVPLLDDMSSPELWNQVGTVLDGERALGAAEAGLSDALYGLIGQATTGKSRL
VALRRAVHNRRALTDRYWNDEVRASLPPAVTAGVRSWTELLAEHERATARLDELVAHRTAEQHLLLRKAV
ADPGFQHGLVLSSPVLYRQVRKWLARPDEAVPDHSLALRLAKYLARVTMKTSPFSTFTVSGLGVWREPDA
RPAPAPAPGLAVVTVAEINVWVVQQVVRQLSLRPVLAARMRLRLNPSAHLADGRWEFLGTGPEEPLRRLP
AGAAVAACVAAVGEAGRVRADAAREIATRTGNGVDAADTYLGRLVELGLLEAERPFADQALDPLAALRDW
LAGAGPDTAALVGEVDALAALVARYPTLPDAADRLRCGTAIEEVLRRVRDLAGPEQIQLPAKNSVIENAL
LAEPLAGPVRQDWEPVLRDLDTVRRCYAVLDPALPGRVALADTFAERVGTGASMPLLTFHRTVQEWLRED
PELPGLLSIATHGYASLLDHRLPRIRELAARRADLCALAAPVHADEDGVVRLDPARLADLADGWPRWMRA
PDSVAFYGQPLDGPDARFVVNAVNSGHGRGRDRISRLLTQAGTEARAKTAAPDDAVIVADTCRHFGSNVG
LRRSAVAAEIDYPEGHSERAAEHRIPLSDLLVRHDPARGLLVLWSRGRDTEVRPVHPNLIAELWLPPAIR
LLLQVFGATSNLLIPGRRMFGDPSLAEVGGVLAEPRVTVGATTVSRRQWVFPASAVPVREKGASDRAHLL
RLAGWLREHGIPRRCFVRALDPASVVGGSVWRIKSRKPLYVDFANLLLAGVFERAVAGDGQVLFLQEALP
GPDGMPGYGDSGPRVTEFLIEINGGQDAGERQRPA