Home 

Gene Symbol:  
cltC
Organism:  
Streptomyces hygroscopicus 10-22
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
16069..17757 [-1], 1689 bp
Product Function:  
mcbC-like oxidoreductase
Product Locus:  
 ACS50132.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =1.20E-180;  Score=592.8
  
Nucleotide Sequence:1689 bp
>cltC|ThioFinder211 Streptomyces hygroscopicus 10-22
GTGGCCGACGCGGACGCCGACACCGTCGGACTCCGCTTCTGGCACCGCACCTTCGAGGGCGTCCGGGAAC
TCTTCGCGGAGGGCCACGGGGAGGAGGGCGGGGCGGACGATCCGCTGCCGGCCAAGACGTACCGCGGGCT
GCCCCGGCATCCGTTGAGCGCGCCGGCCCGTGCGGTGGGCGACGCGCGATGGTCCTTCGCCTCCTTCCGC
CGGGCGCACCCCGGCGGTGCGCCGTGCCTGGACCGTCTCGAAGAGCCCGCCGTGTCGGTGCTGCTGCACT
GCGTCTACGGGATGGGTCGCATGGAGGTGGGACCGCACGCCGTCTGGCCGTATCACCGGCTGGTGGCCTC
GGCCCGCTGCTTCTATCCGGTCGAGCTGTATCTGTGGACGGCGCGACCGGCCGGCGAACTGGGCGCCGGC
TGCTACCACTACGACCCCGCGCACCACGTCCTGACCAGGCTGCGGGAGGGTGGTCTGCCGGATGTGCTAG
TCGCCGCCGTCGGAGTGGAACGGCCCGCCGCCGTGGCCCCCGGAGCGCACGACGCTCCCGACGCCCTGCT
CGTGGCGGCGGTCTGCTTCCGCAAGGCGGCCTTCCGCTACCGCGACTACGCGTACCGGCTGTGCGCCCAG
GAGGCCGGTATGACGGTCGGCAACGCCCTGCTCGCCGCGGGCGCGCTCGGGCTGCGGGCCCGTGTGCACC
ACCGGTTCGACGACGAGGTCGTCAACCGGGCTCTAGGGCTGGACGCGTCCGAGGAGACCTCGGTCGCCGT
CCTCGATCTGCGCACCGGTCCACTGCCCGCGCCCGTCCCGGCCGCGCAGCGTCCCGCACCTTCCCCACCG
CCGGCCGGCGCCGCCGGCAAAGCGTCGCCGGCCACCGCCCTGCCTGCCATCCGGGCGGCGCACGTGCGGA
CCAACGCGGTTGATCCCGCCGCCTGGTCGGGACTGCTGGAAGTCGACCGGGCCGCCAGGCGGACCTGGGC
GGCCGGGCGCCCGGCGGTGGACCCACGGGCCTTCCACCTCCCGGCCGGCGTGCGGGGCGGTGAACGGCAA
CTGTCCCTGGCGACGCCGACCGAACCCGGCCCCGGCGAGATCGAGTTGGCCGCCACGCTGCGGACTCGTG
ACTCCGGTGGCCGGATGTTCCTGCCGGGCGGGGATCCGCTGCCCGTGCACCGGCTCGCCTCCGTTCTGCG
GCATGCCCTGGAGCCCGTGCCGTCCGATCACACCAGCCGGGTCTGCCGCCCGCTCGTCGACTGCCATGTG
CTCGCCCTCCGCGTCGACGGCCTCGACACCGGGCTGTACCGGCTGCACCCGGCCCCCGCCCCCGTGCTGG
CGCGCGTGCCGGGACCAAACTGGCGCGGCGTCCTCGCGATGCTCTGCGACCGGACCCCTGCCGTGAACTC
CGCGAAGGCCGACGCGATCGTGTTCCTGACCGTGAACCGGGTCGAGGGGGAGCGGGCGTTCGGGGCCCGC
GGTTACCGGATCCTGCACCAGGAGAGCGGGATCGTGGCCCAGCGCATCAGCGTGCTCGCGGCCGCAGTGG
GACGCTCTGTGCGCATCACCAACGGCTACCACGAGGGAGTCGTCCGCGAGTTGATGGGTGTCGCCGACGC
GGCGTACGTACCCGTGTTCTGCATGGCCGTCGGCCGCCGCAGGGCCACGGCGCAGTACGAGATGCCGCTG
ACATGGTGA
 Primer design

Protein Sequence:562 a.a.
>CltC|ThioFinder211 Streptomyces hygroscopicus 10-22
MADADADTVGLRFWHRTFEGVRELFAEGHGEEGGADDPLPAKTYRGLPRHPLSAPARAVGDARWSFASFR
RAHPGGAPCLDRLEEPAVSVLLHCVYGMGRMEVGPHAVWPYHRLVASARCFYPVELYLWTARPAGELGAG
CYHYDPAHHVLTRLREGGLPDVLVAAVGVERPAAVAPGAHDAPDALLVAAVCFRKAAFRYRDYAYRLCAQ
EAGMTVGNALLAAGALGLRARVHHRFDDEVVNRALGLDASEETSVAVLDLRTGPLPAPVPAAQRPAPSPP
PAGAAGKASPATALPAIRAAHVRTNAVDPAAWSGLLEVDRAARRTWAAGRPAVDPRAFHLPAGVRGGERQ
LSLATPTEPGPGEIELAATLRTRDSGGRMFLPGGDPLPVHRLASVLRHALEPVPSDHTSRVCRPLVDCHV
LALRVDGLDTGLYRLHPAPAPVLARVPGPNWRGVLAMLCDRTPAVNSAKADAIVFLTVNRVEGERAFGAR
GYRILHQESGIVAQRISVLAAAVGRSVRITNGYHEGVVRELMGVADAAYVPVFCMAVGRRRATAQYEMPL
TW