Home 

Gene Symbol:  
cltB
Organism:  
Streptomyces hygroscopicus 10-22
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
13571..15613 [-1], 2043 bp
Product Function:  
putative docking protein
Product Locus:  
 ACS50130.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =4.20E-258;  Score=849.6
  
Nucleotide Sequence:2043 bp
>cltB|ThioFinder209 Streptomyces hygroscopicus 10-22
GTGACCGTGACCGACACCGCCGCAGTCCGCCCCGCCACGGCGGCGGTCCTGGGCAAGGGCCTGCTCGCCA
CCGCTGTCCGGGCGGTGCTCTCCCGCAGCCACGGGACACCGGCCGGGACCGGTGGCGAAGACGCCACCGG
CGCCACGAACGGGATCGGCCTCACCGGCCCCGACAGCGGCTCCCCTGCCGTGACCGTCGTCGCCGACGAC
GGCTGGGCCGACGACTCGGCCATCGTCTCCGCGCAGACGCCCCGCCTGCCCGTCCGGGTGGAGTTGGGCA
GGGTGGTCGTGGGGCCCATGGTCGTGCCCGGGCGCGCGGGCTGCGCCCGGTGCGCCCGCACCCGCCGGGA
GCGGGCAGTGGGGCCGGACAGCCCCCGGGCCGAACTGGTACGGCGATTCGGTGAGCGCCTCGCCGACCAC
CCCGCCCCTGTGCTGACGGCCTGGGCGTGCGACGCGGTCGCGGAACTGGTGGCGGACGAACTCCGCTTCC
CCGGAGGACGGCTGACCCGGTGCGGTCTGGTGATGCTGTCACTGACGACCATGACGGTCGACGCCCATCC
CTTCCTGCCCGACCCGCGCTGCCCCGAGTGCGGCGGGCTCCCGGACGACCGGCCGCCGGAGCTGCTCGGC
ACCGCCCGGCCCAAACCCGACCGGGACACCTACCGGGTCCGCGATCTGCGGGCCGACTGGGAGGCGTTGA
CCCGGACGTACGTCGACGGACACACCGGAGTGGTCCGCCAACTCGACGTACGCACCGACTACCGCTATCC
GATGGTGTCCGCCCCGCTGCACCTGCCGGACGGACAGCAGGAGGCCGGCTTCGGCCGGAACCTCGCCTAC
GCCTCCTGTGAACGCACCGCGCTGGCCGAGGCGTTGGAGCGACTCGGCGGCGCCCGCCCCGGCGGCCGGC
GCACGACGGTGCGGGCCTCCTACCGCGAGGTCGCCGACCAGGCGCTGTGTCCGGTGGAGCTGGGCCTGTA
TCCGTCCGAGCGGTACGACGCACCCGGCTTCCCCTACCCGCCGTTCGACCCGGGAATGGCCCTCGACTGG
GTGTGGGGGCACTCCTTCGCCCGCGACGCGCCCGTCCTCGTACCCGAGGACTACGCGTACTACCGCACCC
GGCACGGCAATCCGGACGCCCGGCCGCTGGCGTACGAGGTGTCCAACGGGTGCGCTCTGGGCGGCTGTCT
GGAGGAGGCGGCGCTGCACGGGCTGGTGGAGCTGGCGGAGCGGGACGCGTTCCTGCTCACCTGGTACGCG
CGGCTGCCCGCGCCCCGGGTGGACCTGGCGACGGTGACCGACCCGCGTATCGCGGTGCTGGCCGAGCGCA
TCCGGCAGGACAGCGGGCACCGGGTCCTGGCCTTCGCCACCACGCCGGAGCACGGCATCCCCACCGCGTG
GGTCATGGCGGTGCACCCCACCGCACGCCTCTTCCCCGCACCCGGGGACCCGCGGGCGGAACCGGCCGCC
GTCTGTGCCGCAGGAGCGCACTTCGATCCCGAACAGGCGTTGCTGAACGGCCTGCTGGAGCTGACCGCCA
ACCTGGGCTGGAACCGTGACGCCTACCGCGAGGAGCGGGAGCGGATCGGGGCGATGGTGACCGACCCGGA
CCAGGTGCGGGACATGCGGGACCACGCCCTGCTGTACTGCCACCCCGCCGCGTTCGACCGGTTCGGCTTC
CTCCTCGGCGACGGGCCTCCCGGCACCGGCGCGCCGGGCCTCCCGGTGGAGGAGGCGTTCGCGCGCGCGG
ACTGCCGGCCGCGCGGCACGGATCTGCGGGACGACCTCATCGAGGTGGTGACCCGGTTCACCCGCCGCGG
CCAGGACGTGATCGTGGTGGACCAGACCACGGACGAGCACCGGGCCGGCGGACTTGCCTGCGCGAAGGTG
ATCGTCCCCGGTCTGCTGCCCATGACCTTCGGCCACGGCATGCGCCGCACCCACGGACTGCCCCGGCTGC
TGCGGCTGCCCGCGCTGCTGGGCTACCGGGCCGGGCCGCTGTCCCCGTCGGACATCAACCCGCACCCGCA
CCCGTTCCCGTGA
 Primer design

Protein Sequence:680 a.a.
>CltB|ThioFinder209 Streptomyces hygroscopicus 10-22
MTVTDTAAVRPATAAVLGKGLLATAVRAVLSRSHGTPAGTGGEDATGATNGIGLTGPDSGSPAVTVVADD
GWADDSAIVSAQTPRLPVRVELGRVVVGPMVVPGRAGCARCARTRRERAVGPDSPRAELVRRFGERLADH
PAPVLTAWACDAVAELVADELRFPGGRLTRCGLVMLSLTTMTVDAHPFLPDPRCPECGGLPDDRPPELLG
TARPKPDRDTYRVRDLRADWEALTRTYVDGHTGVVRQLDVRTDYRYPMVSAPLHLPDGQQEAGFGRNLAY
ASCERTALAEALERLGGARPGGRRTTVRASYREVADQALCPVELGLYPSERYDAPGFPYPPFDPGMALDW
VWGHSFARDAPVLVPEDYAYYRTRHGNPDARPLAYEVSNGCALGGCLEEAALHGLVELAERDAFLLTWYA
RLPAPRVDLATVTDPRIAVLAERIRQDSGHRVLAFATTPEHGIPTAWVMAVHPTARLFPAPGDPRAEPAA
VCAAGAHFDPEQALLNGLLELTANLGWNRDAYREERERIGAMVTDPDQVRDMRDHALLYCHPAAFDRFGF
LLGDGPPGTGAPGLPVEEAFARADCRPRGTDLRDDLIEVVTRFTRRGQDVIVVDQTTDEHRAGGLACAKV
IVPGLLPMTFGHGMRRTHGLPRLLRLPALLGYRAGPLSPSDINPHPHPFP