Home 

Gene Symbol:  
tpaK
Organism:  
Nocardiopsis sp. TFS65-07
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
26673..29462 [1], 2790 bp
Product Function:  
putative dehydratase
Product Locus:  
 ADO67781.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =0;  Score=1079.2
  
Nucleotide Sequence:2790 bp
>tpaK|ThioFinder197 Nocardiopsis sp. TFS65-07
GTGGCATGGGGTTCCGCTTTTCTTTTAAAGGGAAAGCGGAGCCCTCCCTTCCATGTGCTGACCGAGCGGT
TTCTGACGGGGTGTTCGATGAGTGTAAATGTGAGCCCGTACGTTCTCTTTCGGAGGAATAGGATTCCTGT
TTCGGAGGTCGCTTGCATCAATTTTGGCGATTCCTGGTCGGGGATCGATGGAGCGAACATCCTGCGTGCG
GAAGCGGAGAAGTTCGCGGACTCCCTCTCCTCTCTCCTGGCCGGAATCGTGCCGGAGACGGAGAAACCGG
TACGATCGAAGATCGTGCAGTTGAGAAGGGACGTGCACAACGGTCGGCATGAGCGCGTGGTGTCGAGGGC
CTCGGAACTCCGCCCTTACCTGGGAGAACGGATCTTCGGGGAAATCCAGGACTGGGTCGAGGCCAGTGAG
GGCGCGTACCACCGTGAGAAGGAGGCCCGGGAGGCCTTCGCTCGGGAACAGGAGGAGGCCAGGGCGGCCT
TCACCTCGTTGTTCGGGTACGAGGCGATCGGCAAGAGCATCCAGCTCTCGGGCGGCCAGCTTTACCAGAG
CCTGCTCAACTATGTCGAACAGGGACCCGGCGCCTTCAAACCGAGCAAGGTCCGCAACTTCGAGTCGACA
CTGGTCAACTACGTCTACCGGGCGAGCCTGAAGCCCTCCCCCTTCGGCTGGTTCACGGAGGTCGGGGCGT
TCCCGGCCGACCTCGGCCAAGGGAACCGGGCAGACGGCGAGGACGAGGGCACCGGCTCCCCGGTCGGACC
GGCGGCCGCGGCCACCGTCGCGGACGGGGACGCGTCGGTCGCCAAGCTGAACGTCTTCCTCATGAACTGG
ATCGTGGGAGCTCTGACGGGGGTGCCGGGAGGCTGGGGGGTCGGCGTCTTCCTCCTGAACCCCACGGTCA
GAGTCGACGGGGAGCAGATCGAGTTCAGCGGTACCTCCAACGAGTCCTTCCTCCAAGGGCGCATCCACGG
CGAGATGGTGCGGATCAAACGCGACCGCGTCGTCGAGTGCCTACTGGAACTGCTCTCGGGCGGGCCCCGG
GCCGCGGCCGATGTGGCCGGCGCTCTGGCCGACGCCACGGGAGACGAAGGCTACGCGCGGCGTATTCTGA
CGGCCTTGATGCGGGTCGGGCTGGTGTTCTTCCGGGTGGATATCGACGACCAGGACGCGGAGTACTCGCG
CAAGTTCGAGGAACTCCTCCGCGAGGGGGGAACTCCTCAGCTCGCCCGATTGGCGGACGAGTTCTCCGCC
CTGCGCGAGGTCGAGGCGGGGCTCCCCGGCGCGACCATCCCCGAGCGCGAGGCCCTCCTGCTCTCGGCGC
AGCGGTCGGTTTCCGCCATCGCGGAGGCCTGCGGCACGACCCTCCCACCGGAGGTGATGATGCGGTCACC
CGTCTACGAGGATGTGCCGACCCGGACGCGCCCGCGGACATGGAGTCCCGAGACCGTCACCGGGGGGCTC
GACGCGTTGGAGGGCCTGTGGCGCTTCTCCTCCCTCTTGGAGCAGGGGCAGACGAAGCGGCTGGCGCTGT
ACGCCTTCGCCGTCCAGAGCTTCGGAGACCGTGAAGACATCCCCTTCCTCGACTACTTCGCCGCCTTCGC
GAGGTTGCCGAACCAGGAGCAGTGGGCTCTGCTCGCCGGGCGGGGCGGTGACTTGACGGACCTCTTCCTC
GAGCAACGCGACGCGGCCCTCCGCGAGATCCGAAGGAAGACGGTCCTCGAGGGCGACGTCCTGCGTCTGG
ACCCATCCGAACTGTTGGCGGCGTGTGCGTCCGTCGAGGACCTCCGGGACCCCGCCTCCATCACCTTCCG
CCTTCAGTTCTCCAGCGACGGGGGGACCCGGAGCCGCAGACAGCCGGTGGTGAACGGGGTCTTCACCGGT
TTCGGTGCCTTCTACTCGAGGTTCAGCGACTTCGTCCCGGGCACGAACGACGACTGGTCACTGCGCTCAT
CTCTGCGTCGGCACATCGGTCGGACTTTTCCGGACCAGACCGACCTACACGCCGTCCTCGGGTTCAACTT
CAACCTGCACCCGCCGCTGACCGACCGGTCTGTGCTCTACCCGGGGAGCGTCGCGAGCGGCGGTTCCCAA
GAGTTCCTCGGCCTCGACGGACTGCGGCTGCGGGTCGACCACGAGAGCAGGTCGCTGCTGCTCTGGGACC
CCCTACAGGACCGTCGCGTCGACCTGCTGCCGATGAACTTCCTGCTCCCCGTCAACGCGCCCCTGCTGTA
CCAGGTGCTCGACGCGCTCAGCCCCACGGTCTTCTCGACCTGGCAGCCGGTGAACGACATGCGCAATTGC
GGGTACTTCGAGTCCCTACCCGAGTCCTTCCACCGCCTAGAGGTCGGGGACGTGGTCGCCGACCGTAGGA
CATGGACGGTTCCAGCGGAAGACGTCCCCGGCCTGGAGGACCTGAGCCGGGACTCCTATGAGGCCCTCCT
GCGCTTCGACGAGTGGCGCCGTGCACGGGGCCTGCCCCGGCACGCTTTCGTCATGTGCCGGACACTCGAC
GAGTTCAACACGCTCACCGGCCGGATGACGGACATGTCGAAGGTCTGGGGCGAACTGGCGAACCTGAACC
GGGCGAGCGTGCACAAGCCTATGTACGTGGACTTCCGCAACCCCTACCTGGTTCGCAGCTTCGCGAGGTC
GGCGACGTCGCGGTCGGGCGTCTTCGTCTCGGTCACCGAGTGCCTGCCGGCCGTGGAGGACTACGCCGAT
GACCCCGACATCACCGCCACAGAGGAGTTCTTCGTTGAGCTTTACCGAGACCGGGACTGA
 Primer design

Protein Sequence:929 a.a.
>TpaK|ThioFinder197 Nocardiopsis sp. TFS65-07
MAWGSAFLLKGKRSPPFHVLTERFLTGCSMSVNVSPYVLFRRNRIPVSEVACINFGDSWSGIDGANILRA
EAEKFADSLSSLLAGIVPETEKPVRSKIVQLRRDVHNGRHERVVSRASELRPYLGERIFGEIQDWVEASE
GAYHREKEAREAFAREQEEARAAFTSLFGYEAIGKSIQLSGGQLYQSLLNYVEQGPGAFKPSKVRNFEST
LVNYVYRASLKPSPFGWFTEVGAFPADLGQGNRADGEDEGTGSPVGPAAAATVADGDASVAKLNVFLMNW
IVGALTGVPGGWGVGVFLLNPTVRVDGEQIEFSGTSNESFLQGRIHGEMVRIKRDRVVECLLELLSGGPR
AAADVAGALADATGDEGYARRILTALMRVGLVFFRVDIDDQDAEYSRKFEELLREGGTPQLARLADEFSA
LREVEAGLPGATIPEREALLLSAQRSVSAIAEACGTTLPPEVMMRSPVYEDVPTRTRPRTWSPETVTGGL
DALEGLWRFSSLLEQGQTKRLALYAFAVQSFGDREDIPFLDYFAAFARLPNQEQWALLAGRGGDLTDLFL
EQRDAALREIRRKTVLEGDVLRLDPSELLAACASVEDLRDPASITFRLQFSSDGGTRSRRQPVVNGVFTG
FGAFYSRFSDFVPGTNDDWSLRSSLRRHIGRTFPDQTDLHAVLGFNFNLHPPLTDRSVLYPGSVASGGSQ
EFLGLDGLRLRVDHESRSLLLWDPLQDRRVDLLPMNFLLPVNAPLLYQVLDALSPTVFSTWQPVNDMRNC
GYFESLPESFHRLEVGDVVADRRTWTVPAEDVPGLEDLSRDSYEALLRFDEWRRARGLPRHAFVMCRTLD
EFNTLTGRMTDMSKVWGELANLNRASVHKPMYVDFRNPYLVRSFARSATSRSGVFVSVTECLPAVEDYAD
DPDITATEEFFVELYRDRD