Home 

Gene Symbol:  
tpaE
Organism:  
Nocardiopsis sp. TFS65-07
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
17794..19434 [1], 1641 bp
Product Function:  
putative thiazoline/oxazoline dehydrogenase
Product Locus:  
 ADO67774.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1641 bp
>tpaE|ThioFinder190 Nocardiopsis sp. TFS65-07
ATGTCCAAAGAGGTGAGAGCGGAGACGGTGGGCCGGGCGGCCCGGGGCGGAGACCTCCAACTCACCGTGC
CCCTACAGCCGTCCGTGCGGCGGGGGGTGCGGTTCCGAGGGGTCGGTGACGCGGTGGTCCTGGACGGATC
GGACCAGCCGCAGGCCTTCAATGGTGCCTTTGCCCGGGAGACGCTGATCCCGCTCACCGACCTCTGCGAC
GGAACCCGCGGCCACCGTGAGCTGGCGAACAGGCTCGGCCTGGAGCAGGAAACGGTGTACAAGGCGCTCG
CGCTGCTCTGGGCCGCCGGGGGAGTGGAGGAGAGCCCGGGTGAGACCGGTCGGCCGGTGAGCCCGGAGCT
GTCGACCCTGCTGTCCCGCCTCGGTAATTCCACAGGCGCGAACCGTTCCTGGACCGAATGCGTCGACCGC
CTCGGGCACCGCACCGTCCGCCTGGAGGGGCATGGCCTCTCGGTGGCGGCGGCTGGCCGCGCCTTCGGGG
AGGTCTGCACGGTTGTGGAGGGCCCACCGGGAGACGGTCGGTCCGCAGTCGAAGGGGAACTGGCCGTCTT
CTTCGAGACCGGAGCCACCCGACTCGCCTTGGGCGAGTCGGCGGACCGGTGCTGGAGGGAGGGGGTCCCC
CTGCTGCGGGTCCGGGTGGGCTCGGGCGCGGTGACCCTCGGCCCGTACGTCGATCCGGCTCTGACTCCGT
GCGTCGAGTGCGGCACGTGCGATGAGACCGACCATGGCGGCGAACCGTCCGAACACGTGGTGGAGCTCGC
CGCCGGGGTCACAGCGCACCACGTTATGGCCCTGTTCACCCGGGCGACCATGACCCACCTGCCGCTCGAT
GCGAGCCGGATCGAGGTGACCGATCTGTCGACCTCGTACACCTCCGCCGTGAGCCGACCCGGGTGTCGCA
CGTGCTCCCACAGCAAGGGGCCCATCGCCGATACTGTGCCCGACAGCGCGGTCTACGAAGCCTCCGTGGC
CATGCCGCCGCGCGCGTTCCTGGACCCGAAGGGCCACCTCGGCCATTACCAGACCGGGAACATCCGGATC
ACCGCTGAGTTCCGGTCATGGCCGAGCTCACCCAAAGTCGACCTGCCCGAACCCGATCTCTCCCGCCTGG
TCGGCCGCCCGGAAGCACCTGGACACGACCGCACCGTGACTCTGGAGGACCTGAGCCTGGTGCTCAAAGT
CGCCTTCGGGGTTCGGGAACTGCCCACCGCCGAGGGCGGAAGGGTGCGGCGCTGGACCGCGGCCGCAGGC
AACATCGGCTGTACCACCGCCTACGTTCTCTGCCGCGACGACAGCGTGCTGCCCGCCGGTGTCTACGCCT
ACGTGGAACGTGACCACGTTCTCGCTCGACTACCGGGCGAGATCCCTCCGGGCGAGGACCAGATCGAGCT
GGTGATCGTCGGCGACCTGGCCAAGGTGATGCGCAAGTACGGCACCTTCGGTCTGCGGCTGACGATGCTC
GACGCCGGCTGCGAACTTACGAGCGCGCGTGATGTGGCCGAAGCCCTGGGCCTGTTCGTACGCCCCGTGG
CCGACTGGGACGACGGTGACCTGGCCCGAGCTCTGGGCACGTCCCGGAACACCGAACCCGTCGTCGCCGC
CGCCGTTCTGGAGGCCCCCCGTGAGATCTGA
 Primer design

Protein Sequence:546 a.a.
>TpaE|ThioFinder190 Nocardiopsis sp. TFS65-07
MSKEVRAETVGRAARGGDLQLTVPLQPSVRRGVRFRGVGDAVVLDGSDQPQAFNGAFARETLIPLTDLCD
GTRGHRELANRLGLEQETVYKALALLWAAGGVEESPGETGRPVSPELSTLLSRLGNSTGANRSWTECVDR
LGHRTVRLEGHGLSVAAAGRAFGEVCTVVEGPPGDGRSAVEGELAVFFETGATRLALGESADRCWREGVP
LLRVRVGSGAVTLGPYVDPALTPCVECGTCDETDHGGEPSEHVVELAAGVTAHHVMALFTRATMTHLPLD
ASRIEVTDLSTSYTSAVSRPGCRTCSHSKGPIADTVPDSAVYEASVAMPPRAFLDPKGHLGHYQTGNIRI
TAEFRSWPSSPKVDLPEPDLSRLVGRPEAPGHDRTVTLEDLSLVLKVAFGVRELPTAEGGRVRRWTAAAG
NIGCTTAYVLCRDDSVLPAGVYAYVERDHVLARLPGEIPPGEDQIELVIVGDLAKVMRKYGTFGLRLTML
DAGCELTSARDVAEALGLFVRPVADWDDGDLARALGTSRNTEPVVAAAVLEAPREI