Home 

Gene Symbol:  
tpaH
Organism:  
Nocardiopsis sp. TFS65-07
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
22028..23893 [1], 1866 bp
Product Function:  
putative cyclodehydratase
Product Locus:  
 ADO67777.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =1.70E-218;  Score=718.7
  
Nucleotide Sequence:1866 bp
>tpaH|ThioFinder193 Nocardiopsis sp. TFS65-07
GTGACCGACCTGTTCGTCGACGCACTCCTGAGACAGCTCACGGCGGACGGCGGCCTGAGCCGCGTTCGCG
AGGTGAGCCACGGCCCGCTGACGGACCCCACGAGCCACCGGCCGAAGGGGGCCTCGCTCTCTCTGGAGAC
GTGCGTCGGAGTCCTGCACTGGCGGGGACGCGTCCACCTGCTCAAGTACGATCTCTCCGGCACCGGCGGG
TGCCCGTACTGCCTCGCGGGCTTCACTACCTGGCAGCAGGTGTCGGGATTCGTCCCTGAGGAGCACGACG
TCACGGAAGGGGGCCGCGCCGCCGGTCAGGGTGGCGACCCGTTCTGGGAGCTGCTCTCCTCGAGCCTTCG
CGCGCTGGTGCTCCGGCTCGCGGGCGCGCTGATGGACGAGGAACACCCGCCGGGGACCCTTCTCGTGCTC
GACACCGTAACCTGTGCGACGCAACGCCGGACGGTGCCGCCGCGGACGGCCTGCCCCCGCTGCGACACGG
AGGAGACCACGACCCGGGTACGGTTCGATTCCCCTCCGGAAACCCTGGTCAAGGCCGAAGGCGAGCTGCG
CGGACCTAGGAAGCCCGCGCCATCGCTGGCGACCGACTACGTGGGCCCCCAGTCGTTGTTCAGGGAACCG
CTCATCGATGTCGACTCCCCCGCCGCCAACGCTCAGTTGACCATTCCGCTGTTGAACGGGGAGCGGGAAC
TGACGGCCGGCCGATCGAGGTCCTTCGGCCGGAGCAGGGTGACCGCAATCCTCGAGGGCCTGGAACGCTA
CGCCGGGTTCCACCACCGCGCGTCCTCCGGGAAGATCCGTGCGTCCCTGCGCCAGCTCGGTGATCTCGCC
ATCGACCCTCGGGATCTGGGCCACCACTCCAAGGAGCAGTACGACCTGGAAGGGTTTCCCTTCGCGCCAC
TCGGGGACGAGGAGGAGGTGGACTGGGTGGAGGTGTCCCCGCCGGGCGCTGACGCCCCCTGCCGCTACCT
TCCGGAGAACGTCCTCTATTGGGCACGGAGGGGTACCCGGTACAAGTCCTTCTTCGCGGACACGTCGAAC
GGCTTCGCGCTCGGACAGACACCGGAGGAAGCCGCACTGCACGCGGCCCTCGAGGTCGTGGAGCGGGACG
CGTTCATGCTCACCTGGTACCGTCGGCTGCTGTTGCCCGAGATCGTTCTGGGAAGGCAGGACCGTGACTT
GGCTGACCTGGTCGACCGGATCGAGGTCTTCACCGGGTTCCGGGTCCGGCTGTTCTGGGCCGCGGTCGAT
ACGGGTATCCCCGTGGTGATCGCGCTGGCCGCTCGCGACGCCGATTCGGGTCCGTGCAGGTTCTTGTCGG
CCGGGGCCAGTCTGTTCCCCGCAGCAGCGGCGGAGTCGGCGCTCGTCGAACTCGCGGGGCTGGTAGCCGC
CATGTGCGTCGATTTCGAGGACAGGACCGAACGGGCGCACGCGATGTCACTCGATTTTGACCAGGTGCGT
GGGCTGGACGACCATTCTCTGGTCGCGGCCCTCCCCTCCTCCAGAGGGTGGTTCGACTTCCTGACCAGGG
CCGATCGTCCGATCGTCCGCATGGCGGAGCTGTTGAAGGAGAACCCGGGGCACGCGACGGTCCGCGCGGA
CCTCGACTACGTGGCCGAACGTATCGGGGGCGCGGGGGCGTCGGTGTACTTCGCCGACGTCACCACCAGG
GAACTGCGATGGCGCGATCTCGTGTGCGTCCGGGCCATCACCCCTGGTCTCCTGCCGATTACGTTCGGAC
ACCCCTTTCGGAGGATGGAGGGTCTACCGCGTCTGTACGCCGACGCACTCCCGCATCGATCGCTGCTCCA
ACCGGGGGAGTCGCCGCGGGACGTCCCGCCGCATCCCTTTGCCTGA
 Primer design

Protein Sequence:621 a.a.
>TpaH|ThioFinder193 Nocardiopsis sp. TFS65-07
MTDLFVDALLRQLTADGGLSRVREVSHGPLTDPTSHRPKGASLSLETCVGVLHWRGRVHLLKYDLSGTGG
CPYCLAGFTTWQQVSGFVPEEHDVTEGGRAAGQGGDPFWELLSSSLRALVLRLAGALMDEEHPPGTLLVL
DTVTCATQRRTVPPRTACPRCDTEETTTRVRFDSPPETLVKAEGELRGPRKPAPSLATDYVGPQSLFREP
LIDVDSPAANAQLTIPLLNGERELTAGRSRSFGRSRVTAILEGLERYAGFHHRASSGKIRASLRQLGDLA
IDPRDLGHHSKEQYDLEGFPFAPLGDEEEVDWVEVSPPGADAPCRYLPENVLYWARRGTRYKSFFADTSN
GFALGQTPEEAALHAALEVVERDAFMLTWYRRLLLPEIVLGRQDRDLADLVDRIEVFTGFRVRLFWAAVD
TGIPVVIALAARDADSGPCRFLSAGASLFPAAAAESALVELAGLVAAMCVDFEDRTERAHAMSLDFDQVR
GLDDHSLVAALPSSRGWFDFLTRADRPIVRMAELLKENPGHATVRADLDYVAERIGGAGASVYFADVTTR
ELRWRDLVCVRAITPGLLPITFGHPFRRMEGLPRLYADALPHRSLLQPGESPRDVPPHPFA