Home 

Gene Symbol:  
tpaG
Organism:  
Nocardiopsis sp. TFS65-07
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
20217..22031 [1], 1815 bp
Product Function:  
TpaG
Product Locus:  
 ADO67776.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =8.80E-192;  Score=630.1
  
Nucleotide Sequence:1815 bp
>tpaG|ThioFinder192 Nocardiopsis sp. TFS65-07
TTGAGCCAGAGCACTGAGGACACCGGCCACCGGGGGTTCGTCCTGGCGCGTTCCGACGTGGAGGTCGCCG
GGACGGACGAAGGTGCGTGGATCGGCATCTCCGACTCCTCGTTCACGGTGCGGGGGAACGGAGCCCATCG
CCTCATTCGCGACCTGGTCGCTGGATGCGACGGCAGGGCCACGGTCCAGGACGTCCTGGACCGTGGCCCC
GGAGCAGGACGCCCGGTGGCGGACACACTGCTCAAGGCGTTGGTCCGGCGCCGCTACGTGGTCCTGCTCG
ACCAGCCGTTGGGTGGAGCCGGGGCCGGGTCGGCGCCTGATCCCCTGATCAGGCAGTTCGCGCACTGGAC
CGAGGACTCCTCCGCGGCGGTGGCACGACTGTCCGGAAAGAGCCTCCGGCTGGTCGGAGAGCCCGGGTGG
TTGGAACGGGTGCGCTCGGAGCTCGACGGCCTGGTGCCCCCCGGTCTCCGAGTGGAGGACCTTCCGGTCA
CCCCCGGTCGAACGCGCGCCCCTCTCCTAGACACGTATCCGGGAGAACCGGCGTCCGCGTCGTGGCAGGC
GGGCGATGTCGTCGCGCTTCAAGCCGACGCGTTCTCCGCCGACGAACTGGCCCGGGAACAGAAGAGCCTG
TGGAACCACGGGGCGCCGCACTGCGTGGCCGGGCGGATAGGTTCCCGGTACTGGCTGCTCTGGTCGCGCG
ACGGTGGGACCGGCTGCTGGCGGTGTCTTCGAAGCCTGGCCCTGGCGGCCGAGGTGGCGGCCCCGGACAC
CGGTGTCGGAGCGCTCACGGACGTAGCCGGCCATGTGAGTGTGGCGAACCTGGTCCGGTCTCTGCTCGCC
CGCGCTGCAGGGATCGACGACGCATTCGGGACCGCTGACGCGCTCTCGGCGGACGTACACGAACTGTCGG
TGCGCACGCACACGGTCGTGCGGCGGCCCGGTTGTGCCTGTCGCTGCACGGAGTCACGGAAACCAAGACA
CGGCTCCGGCCCTGCCGAGGCGGTCATTCGCCGGAACTTCTATGCCTCCGACGACTCCGACCGCTCCGAC
GAGCACCACGCGGAGATCATGGGCACCCTCGCCTCTTGGACGGACGAACGCGTCGGCCCGTTCCTGGAAA
TCGATCGCGACACCCTCCCACAGGTTCCGTTGGGCGCCGCCTACGCGCGGGCCCTGAACCTTGTTGACGA
ACACGGGGGGATCGCAGCCACGGTTCGCACGCTCTCCTCCCGAGAGGCCTACTACCAGGCGGCACTCAAC
GTGCTCGAAGTCACCTCGAGGCACGGTGCCGGGGAGACCGACCCGGCGCGGTACACGGGCGCGGGCTGGA
CACATGGCGAGGCCACCTACCGCGCACTTCTGCGCTCCCTGCCCGGCGCTCCCTCCGACCCGCGGACCAT
GGCTCCGCTCGACCTGGACGACTCGAGTGACGGTGAGTGCGCCCGGATGGCCCGGTACCTGGAACGGCGC
CTCGGGAACCGGGGTATCGGCGGCACCTGGCTGGGCGAACACCTCGGAAACGGGCTCTGCCACGCGGCCC
TGATCGCAGAGGGCGGGCCCGCCGTCAGCGGTTACGGAGCCTGCTACGGCGAGGCTGTGGCGATGGCTCT
GCTGCGCACGGTCAACGACGGGGTCCTCGTACACGTCAACCCCCACCACACCACCTGGGGCGACTTCTGG
ACACAGGTCACGGCGCCCGTGGGTCTCGAGGACGTGTCCCTGCCGTTCGCCCAAGGCCCGGCCCGGATCG
TCGGGTTCGTGCCAGAGTCCGGAGCCCGCCGACCCTACGATCTCGCGGAGGTGTCCGTCCCGTGA
 Primer design

Protein Sequence:604 a.a.
>TpaG|ThioFinder192 Nocardiopsis sp. TFS65-07
MSQSTEDTGHRGFVLARSDVEVAGTDEGAWIGISDSSFTVRGNGAHRLIRDLVAGCDGRATVQDVLDRGP
GAGRPVADTLLKALVRRRYVVLLDQPLGGAGAGSAPDPLIRQFAHWTEDSSAAVARLSGKSLRLVGEPGW
LERVRSELDGLVPPGLRVEDLPVTPGRTRAPLLDTYPGEPASASWQAGDVVALQADAFSADELAREQKSL
WNHGAPHCVAGRIGSRYWLLWSRDGGTGCWRCLRSLALAAEVAAPDTGVGALTDVAGHVSVANLVRSLLA
RAAGIDDAFGTADALSADVHELSVRTHTVVRRPGCACRCTESRKPRHGSGPAEAVIRRNFYASDDSDRSD
EHHAEIMGTLASWTDERVGPFLEIDRDTLPQVPLGAAYARALNLVDEHGGIAATVRTLSSREAYYQAALN
VLEVTSRHGAGETDPARYTGAGWTHGEATYRALLRSLPGAPSDPRTMAPLDLDDSSDGECARMARYLERR
LGNRGIGGTWLGEHLGNGLCHAALIAEGGPAVSGYGACYGEAVAMALLRTVNDGVLVHVNPHHTTWGDFW
TQVTAPVGLEDVSLPFAQGPARIVGFVPESGARRPYDLAEVSVP