Home 

Gene Symbol:  
cpfrc_01627
Organism:  
Corynebacterium pseudotuberculosis FRC41
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1777031..1778044 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003784027.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =5.50E-46;  Score=148.9
  
Nucleotide Sequence:1014 bp
>cpfrc_01627|ThioFinder552 Corynebacterium pseudotuberculosis FRC41
ATGCGTACCACAGACCCCTGGCTGGCATTTCATATTTTTTATGGAGAAGACCCCTCTCACCTACTCCGCG
ACTGCTTATTACCTTTTGCTCATGCTTGCGTTGCAGAGGGGCTGGTAAGACGCTTCTTCCATATGAATTA
CTGGCTCGAAGGCGCTCATGTTCGCTTACGGTTAGAGCTGTCCAGCCCTGCGGATCGTGAGCGCGTCATA
TATAAAGCGCATCACGCTATCCAGCCATGGATCGATGCCCACCCTTCTAGTGCTCCCCAGTTGTCCTTGC
GTAATCCCGAAGGCTATCGGCGTCTTTTTGAACACGAATACCCTATGTCCAGGTTTTCTGATTACATCGA
TCAGGATGGCTTACCTCGCCTACAGCCAGATAACTGCATCCGAGAACGCTACTACGAGCGCGAATATGAC
CGCTATGGCGGGCCAGCAGGGATGTCACTTAGCCAAGACATTTTTCAAGCCTCCACATTGTTCGTCGAAA
AGCTTTTGCGCTCTGGAGTTGTAGAAGCCCGCACCTCGCGTTTAGCCACAGCTGCTCTAGGAATGGTCTG
CACCGCGCATACCTTTTTATCCTCCGACGAGTCCATAAGTATCTTTTGGGAGAGCTACCACCGTGGCTGG
ACTTCCTCTTTTTCCATCCCCACCAGCTACACTTCCCCCGCTGCACAACAAAAAATCGCAGCCGAGGCTC
AGGCGCTCTCCCGCGCAGTCACGCCGTTCCGCGATGCATTACACCGCTATCCAGACGGTTCTTCCCTCCC
CGAACCTTATGCAACTTTTACTCGGCATATGGCCTCTGTTGTTGAGAAACTCCATGCTGCTCATGCTGCT
CAAGAGTTGGATTTTGGAGATTCTGTGGCGGAGGCTGGCCACACGTGGAAAGAAAATTCCACTTTTCTTC
TGCGTTCTTATGTGCATATGACCAACAACAGGATGTCCGTCAATATCTCGGATGAGGCATATCTGGCTTA
TTTATTACAGAAGTTATATCGGGAGACGCCATGA
 Primer design

Protein Sequence:337 a.a.
>Cpfrc_01627|ThioFinder552 Corynebacterium pseudotuberculosis FRC41
MRTTDPWLAFHIFYGEDPSHLLRDCLLPFAHACVAEGLVRRFFHMNYWLEGAHVRLRLELSSPADRERVI
YKAHHAIQPWIDAHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLQPDNCIRERYYEREYD
RYGGPAGMSLSQDIFQASTLFVEKLLRSGVVEARTSRLATAALGMVCTAHTFLSSDESISIFWESYHRGW
TSSFSIPTSYTSPAAQQKIAAEAQALSRAVTPFRDALHRYPDGSSLPEPYATFTRHMASVVEKLHAAHAA
QELDFGDSVAEAGHTWKENSTFLLRSYVHMTNNRMSVNISDEAYLAYLLQKLYRETP