Home 

Gene Symbol:  
HMPREF9948_1493
Organism:  
Propionibacterium sp. 434-HC2
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5627..6946 [1], 1320 bp
Product Function:  
YcaO-like family
Product Locus:  
 ZP_08546059.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
link HMMER3 searches:  
E-value =2.3e-65;  Score=213.7
  
Nucleotide Sequence:1320 bp
>HMPREF9948_1493|ThioFinder1342 Propionibacterium sp. 434-HC2
ATGACAGTTGAGCGTCAGCCTCTGCGGGAGCGTGCAAGGAGCCTCGTTTCACCATACGGACTAGTTTCCC
AAGTACACCCTCTGCACGCCAATGAAGCAGATCCACCGTTTCATGTGCATTTGGGTCGAACAGGCCACTC
AATACACGAGGGGCAAATTACTTTTGAGGGAGATATCGGAAACACCGACGGGGCAGGGTCGGGATCCGAC
AGTACCACGGCAGAATTTATTGCAGTAATGGAGTCCTTAGAGCGCTACTCCAGCGCAATGTGGGACGCTC
GTTCCTTTTTGCTGGAATCGGAAAATAATCTGCAGGAGCGACTTGTATCTCCCAACCAATTCCCACGCTG
TTCTACAGCCGAGCTAGATTCTGGACATGTACTCAGGCGGTACGACCCGGGCGTCCCAATACGATGGGTC
AGAGGATGGTCACTGACTTCAGGTCATCAGGTGTGGGTTCCGGCGATCGCGGTTTATCTGCATCTGCCGT
ACTTAAACGACTCTGAACGATTCATACGTTCAGTCTCGACCGGATGTGCGGTTCATGAATCCATGCGGAA
GGCTGTTCTTAACGGTCTTTTAGAAGTCGTCGAGCGAGATGCTATTGCTTTGACTTGGTTGCATGAGTTG
CCCTTGCCCAGAATCGCGGCTAGCGAGGCCGGTGAGTTCCCGCCGGAAGCGCTAGCCAGTTGGAAGTCAT
ATAGGGATTACGGAATCGAGACCCATCTCTTTGACGCAACGACGGATTTTGGGATTCCGGTGATCTTTGC
GCTCCAGATATCGGATCAGGATGACGACATCGCTCAGCTCGTAGGCGCTGCATCCGCTTTGGAACCCGCT
GAGGCGCTGACTAAAGTATTCAGGGAAATGGCATCGATCCGAATAGCACTACGCGCCTTTCTCGCCCAGT
CCACATCGATTAAGATTTACCCCGATGTGGCTAACGTGACAGGGGGTGCCGCCCTCATGGGCCAGCGCGC
GTACCGAGATGCATTTTCCTTCCTCCTTAACAGCGAGCGCGAAACGTCACCGTCGCGGATGCCTAACCTC
CTAGAGCTGAATGATGATCCACTGCGCGAGATGATTATTCGAATACGCCTGGCTGGCGCTGAAGTTATCG
CCGTCGATATCACGACGGACGAAGCGAGGTCAGTTGGTGCAAGAGTAGTGAAGGTTTTGGTCCCAGAGGC
GGTTCCACTCTCCTTTGTTCACCGAGAGAGGTATTTAGATACTCCTCGGCTCATATCCGCGCCTAATAGC
ATGGGATATTTGGTTGACACAGCGCCTACGTTCAACCGGAACATTCAACCTTTTGCGTGA
 Primer design

Protein Sequence:439 a.a.
>HMPREF9948_1493|ThioFinder1342 Propionibacterium sp. 434-HC2
MTVERQPLRERARSLVSPYGLVSQVHPLHANEADPPFHVHLGRTGHSIHEGQITFEGDIGNTDGAGSGSD
STTAEFIAVMESLERYSSAMWDARSFLLESENNLQERLVSPNQFPRCSTAELDSGHVLRRYDPGVPIRWV
RGWSLTSGHQVWVPAIAVYLHLPYLNDSERFIRSVSTGCAVHESMRKAVLNGLLEVVERDAIALTWLHEL
PLPRIAASEAGEFPPEALASWKSYRDYGIETHLFDATTDFGIPVIFALQISDQDDDIAQLVGAASALEPA
EALTKVFREMASIRIALRAFLAQSTSIKIYPDVANVTGGAALMGQRAYRDAFSFLLNSERETSPSRMPNL
LELNDDPLREMIIRIRLAGAEVIAVDITTDEARSVGARVVKVLVPEAVPLSFVHRERYLDTPRLISAPNS
MGYLVDTAPTFNRNIQPFA