Home 

Gene Symbol:  
SchaN1_010100008060
Organism:  
Streptomyces chartreusis NRRL 12338
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2127..4739 [1], 2613 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_09951905.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2613 bp
>SchaN1_010100008060|ThioFinder1631 Streptomyces chartreusis NRRL 12338
ATGACCAGCCCCGAGCCCCAGTGGTTCCTGCGCGTCAACCCGCTGCGCAGGGCCCGCCTCGCCGACCCGG
AGCAGCGCCGCCTGCTCCGTGAACTCGCCCGCGCCGAGGCCGACCTGGCCGACGCCGCCGAGACGTGCTC
GCAGGAGCTGTACGAGCGGATCGGCGCGGCCGCCTCGGACACCGAGCGCCGCGAGCTCATCGCGCTGCGC
CGCGCCATCCACAACGGCCGCGCCCCCAAGAAGACGCCCGAGGGCCCCGAGGCGACCCCCTCGGTGACCC
GCTGGCTGGCCGCCCACGCCGGGCGGGAGCGGCTCCGCGCCGCGATCACGGAGGGCTACCCGGCTGCGGC
CGACCGCGAACGCACCGTCCTGGCCGCCCTGTTGGGCGACGGCGACCTGCTGCGCTCCCTCGCCCTCGTC
GCCCCGGAGGTGCACCAGGAGGCGGAGCGCTACCGGGCCGCGGTCGAGGGCCCGGGCAAGGTGTCCGCCC
GCACCCGCAAGTCGGAGCGCGGACTGATCCAGTACGTGACCCGGGCGATGGTGCGCACCAGCCCGCTCTC
CCGGTTCACCGCGGTGGGCATCGCCGAACCGGCCCCGGCCGGCGATCCGGAGGCCGTCCGCCCCGGCGAG
GTGCCCTTCACCGGCGCGCGGGCCGTGCCGGGCCTGGACCGGGTCATGCTGCACTACGTCCTCGGCGGCC
TGCCGGCCGACGGCACGGACCTCACCGGCCTGTGGGTGGGGATGCCGCCCACCTCGGCGCCCGACCCGGA
GACGGGCAAGCTGTTCTTCCTGAAGTTCTCCGAGCAGGGCATGCACCGCCTCGCCGTGCCGCTCGACGGG
CCCGTCGGCGATCTGCTCGACGCGCTGTCCATGGGGCCGCGCAGGTTCCCGGCGGTCGTGGCGCACGTCG
CCCGCCGGGCCGGCTGCTCCGCCGAGGAGGCCGAGCGGCGCGTACGGCAGGCCCTGCACCAGGGCGTGCT
GTGCACGTTCGGCCGGCCCGAGGAGCAGACCGCCGCAGGCGACTACGACGACCTGCTGACCCTGCCCGAG
TCCGAACAACGGGAAGTGGTGCGGGAGTTGGCGGACCGGGTGCGGACCGGACTGCCCCGGGTGACCGAGG
CGCCGGCTGCCGAGCGGGGCCCGGTCCTGGCGGAACTGCGCGGGGACCTCGGCCGGTTCAGCCAGGCGGT
GGGCCGCCCCGCGCAGATCACCGTCGAGGAGGACTACGTCATGCCGCCGCTGAAGGTGGCGGCCTCCGAC
TGGCACACCCCGCTGGCCGACCTCGGCCCCGCGGTGGAGCTCCTCACGGTCTTCGACTGGCTGCACGACG
TACGGGTCCTGATGACCGCCGCGTTCGTGGAGCGGTTCGGCGCCGGGGCGAACGTGCCGCTCGCCGAGCA
CGCGGCGTTCATCGTCGGGGAGGTCTCCCGGCGGGCCGCCGCGATGGCCGCCGTGTACGGGCCCGAGGGC
ACGGGGCAGGCCGCCGCGCTGTCCGGGATCGGACCGGCCGACGGCTGCCTGGAGCGCATGTACCTGCTGC
GCCGCGAGCTGTCCGAGGAGGTGCACGCCCTCCTCACGAAGACGGCCCAGGCCGGTGAGGACACCCTGAG
GCTCACCGCCGGGGACGTCGCCGAGCTGACCCGGTCGCTGCCCGACCGCTTCCGCAGCGACCCGCTGATC
TACGGCGTGCTGCTCCAGCAGGCCGGCGACCAGCTCGTGCTCAACGACGGGCTGCCGGGCCACGGCATGC
TGTACGCGCGCTTCCTCGAGGCCGACCGCCGCCAGGGCGGCCGCGCCCTGCCCCGCCTGGCCGACCACCT
GCGGCGCTTCTACGGCCACGACGGCACCCGCATCACCGAGGACCTGGGCCTGCACCGCCTCAACGTCAAC
GCGCACACGCCGGTGCTGCCGGGCGGCCTCACGGCGGAGGACTGGTTCGGCCTGCGCCTCGCACACGACC
CGGAGTCCGACACGCTGCGGGTGGAGGACGCGGACGGCGCCCCGCTGCGGGTGCTGCCGCTGGGCACGGG
CCACCCGGGCCTGTTCCCGCCGCCGCTGTCGGTCGCCTCCGGCCTGGTGATCAGCGGCCGGCTCTTCAAC
AGTCTGCCCAACTCCTGGCACGCGGCGACCCCGTGGGACGGCAAGCAGACCCGTGTCGCGCCGCGCATGG
CGGTCGGCGACGTCCTCATCGGTCGGCGGCGCTGGTACGGCGGAGCCGAACTGGACACGGCGGTGGCCAC
GGGGCCCGACGAACACGAGCGGCTGCTCGCGCTGACCGCGTGGCGGGCCCGGTACGGCGTCCCCGAGGAG
GTCGTCATCAAGTCGACGCCGGAGGACGAGGGCCCGCTGTCGGTCGGAGCCCCCGACGTCCAGTCCAAGC
GCCTGGCGCAGAAGCCGCAGTACGTCGACCTGTCCAGCGCGCTCGCGGTGCGGGTCCTGCCGCGGATGCT
GGAGCGCCGCGGGGCCGGGACCAGCTACCTGGAGGAGGCCCTGCCCGGCGTCACGGACGGCACGCACGCG
ACGGAGTGGGTGCTGGAAGTCGGGCGCAGGGCCGGGGGGCGGTTCGTGTACGACCCGGTGAACAACGGCG
AAGCGGAAGGAGTCCGGCCGTGA
 Primer design

Protein Sequence:870 a.a.
>SchaN1_010100008060|ThioFinder1631 Streptomyces chartreusis NRRL 12338
MTSPEPQWFLRVNPLRRARLADPEQRRLLRELARAEADLADAAETCSQELYERIGAAASDTERRELIALR
RAIHNGRAPKKTPEGPEATPSVTRWLAAHAGRERLRAAITEGYPAAADRERTVLAALLGDGDLLRSLALV
APEVHQEAERYRAAVEGPGKVSARTRKSERGLIQYVTRAMVRTSPLSRFTAVGIAEPAPAGDPEAVRPGE
VPFTGARAVPGLDRVMLHYVLGGLPADGTDLTGLWVGMPPTSAPDPETGKLFFLKFSEQGMHRLAVPLDG
PVGDLLDALSMGPRRFPAVVAHVARRAGCSAEEAERRVRQALHQGVLCTFGRPEEQTAAGDYDDLLTLPE
SEQREVVRELADRVRTGLPRVTEAPAAERGPVLAELRGDLGRFSQAVGRPAQITVEEDYVMPPLKVAASD
WHTPLADLGPAVELLTVFDWLHDVRVLMTAAFVERFGAGANVPLAEHAAFIVGEVSRRAAAMAAVYGPEG
TGQAAALSGIGPADGCLERMYLLRRELSEEVHALLTKTAQAGEDTLRLTAGDVAELTRSLPDRFRSDPLI
YGVLLQQAGDQLVLNDGLPGHGMLYARFLEADRRQGGRALPRLADHLRRFYGHDGTRITEDLGLHRLNVN
AHTPVLPGGLTAEDWFGLRLAHDPESDTLRVEDADGAPLRVLPLGTGHPGLFPPPLSVASGLVISGRLFN
SLPNSWHAATPWDGKQTRVAPRMAVGDVLIGRRRWYGGAELDTAVATGPDEHERLLALTAWRARYGVPEE
VVIKSTPEDEGPLSVGAPDVQSKRLAQKPQYVDLSSALAVRVLPRMLERRGAGTSYLEEALPGVTDGTHA
TEWVLEVGRRAGGRFVYDPVNNGEAEGVRP