Analysis of the proteins responsible for The DNA degradation (Dnd) system

DndA DndB DndC DndD DndE
Dnd protein DndE
Putative function Putative sulphotransferase
DndE sequence of Streptomyces lividans 1326 MPSEITIRLSQAAKDQLSWLKRHTGLTQWNELCRWALALSLRDPSTPLVREIITDSNVEIAWKTFAGPHGDIYLALLKQR
CVADGDEPTDAAVGKTLLIHLHRGIGFLAGRQDLRSIQNLIAVTAE
Length 126 aa
Homologues in dndDB  32 
Consensus based on Muscle-derived MSA in dndDB MMRMLPNRMRLSRAAEDQLKKLKGRTGITPWNVLCRLAFFRSLESPFRPPPEGDEIKLDGGLELDKYTWLGETGDVYELL
LKMRYPEEGAELEDKSLQKAWAAHVERGIAALRNRKSLKSLSNAIKLLAKA
Length of Consensus 131 aa
NCBI-BLASTP similar proteins  16 
Putative conserved domains in pfam highlighted: PF08870, Domain of unknown function (DUF1832)


Pfam-A Matches:
Putative conserved domains in CCD pfam08870, DUF1832, Domain of unknown function (DUF1832)
Consensus match found in PDB by using PDBsum at EBI No significant hit found.
Literature
Cross-references Sequence database UniProtKB search: dndE
Protein family database InterPro: IPR014969, DndE
Interesting links TMHMM v. 2.0, Prediction of transmembrane helices in proteins
SignalP v3.0, Prediction of signal peptide cleavage sites
Jpred v3.0, protein secondary structure prediction
Last update 24/06/2008
PF00266 PF02662 PF04214 PF08870