Protein information:

HomologueDndC
OrganismStreptomyces lividans 1326
Locus tagSLG78
PID2028
GID1028
length498 aa
DEFINITION conserved hypothetical protein
gi  145244343
other link: ABP49154.1
SequenceMSTPKAAAPFQDRPLAEIVEELTEEIRELYVADEVPWVVGYSGGKDSTAVLQLVWLALKDLPAEQRTKPV
HVISTDTLVENPVVAAWVGQSLDTMRTAAQEQQLPIESHKLTPEIKDTFWVSLIGKGYPAPRPKFRWCTE
RLKIKPSNAFIRRVVRRHGEAILVLGIRKAESQARARAMARHEKGRVRDRLSPNGNLPNSLVYSPIEAWS
TEEVWAFLMQYPNPWGHKNKDLLTMYQGASDDSECPLVVDDTTPSCGDSRFGCWTCTLVEQDKSMTAMIR
NDDEKQWMRPLLKLRNELDDVTKEAQTRDFRRMNGNVQLFGDRPIPGPYKQSAREDWLRKLLAAQAQVRK
KAPEHVRNIELISMAELQEIRRIWVFEKHEVEDSLPQIYEQATGEKFPGLPLDEQLVLGAEEIGLLKEAC
EDDPIHFSMTRELLAIERQYRTMTRRAGLFEALEKAIKKGYYEDADDALRFAKRLQEMRESDPTQTTADE
EITTDAPA