Protein information:

HomologueDndB
OrganismVibrio fischeri MJ11
Locus tagVFMJ11_A0171
PID2086
GID1086
length359 aa
DEFINITIONDNA sulfur modification protein DndB
gi  197337419
other link: YP_002157728.1
SequenceMNNHESGYCYSFPAVKGIQAGRPFYIATCPLRIIPKIFSYNEDDVPPELRAQRTLNKTRIPEMVRYLLEN
PTEYVFSALTASVGVDISFNEHEGAPNLGILHIPMDAQILINDGQHRRKAIEEALRENPDLGQDNIAVLF
FIDEGLDRSQQMFADLNKYAVKPSPSLGTLYDHRDESSELARLLASSVQPFIGLTEMEKSNISPKSNKLF
TLSSIKQSTRALLSKGAKDGFNDEEKALASEYWQEVTKHIKDWQLVLKKEVSPAQLRQEFIHAHGLGLHA
LGLLGKHLLCQEPNNWKEKLSLLSEVDWRKTNKDWLQRSMNHGKLSKSTTNIQLTTNALKMKLGLTLTPE
EQTLEKQLS