Protein information:

HomologueDndC
OrganismVibrio fischeri MJ11
Locus tagVFMJ11_A0170
PID2087
GID1087
length544 aa
DEFINITIONputative sulfurtransferase DndC
gi  197336779
other link: YP_002157727.1
SequenceMIHDLQLTEDLAEEYQEFINTEDFANHKLSHYVADVQRVYCADNRPWVIGYSGGKDSSAIMSLVYLALLG
LKEEDRTKQVFVVTSDTLVETPVVVNHINDSLAAIQTGAKRDGLPITCHKVVPEDDQTFWSSLLGKGYPA
PTRSFRWCTERMKINPVSDFIKSKVSQFDEVIVVLGSRSQESASRAQVIAKHKIDGSRLARHTTLANAFI
FTPIDTWGVDDVWKILRLCHLVTKETPYGTKNIWSNDYDLEWENPWGGKNLTLWNLYKDSSGQGECPMVI
DETTPSCGNSRFGCWTCTVVTRDRAMESLIQNGEEWMAPLLEFRNKLAMTTDPANKEEYRNHKRRTGKVS
YQYAKEGEDIASERKHVPGPYWLKYRRQWLRELLELDKKFKAEGREIELITVPELHAIRQEWIKDPNEPD
WDDSLPTLFKDVYGYDLDWVYDDNASFGKDDAQLIHELCDNFDVEPEMIMKLIELEVSMEGLSRRSGISN
KIASLLKRDWGSLEDIKQKHASLQSKAEFDIHQKEIERYNEQLADLDKQLQKEF