Protein information:

HomologueDndD
OrganismVibrio fischeri MJ11
Locus tagVFMJ11_A0169
PID2088
GID1088
length654 aa
DEFINITIONDNA sulfur modification protein DndD
gi  197336972
other link: YP_002157726.1
SequenceMHEIDLRPAPARLSKNGPIEGTERPIILFGGLNGAGKTSILTAVRFALFGRQSFSQVLSNGEYVDALSEL
IHKGVGHGGVQDNASIELEFKYSQNGEENTYKVIRGWKRGKKDNLYLEKDGIQIPELNYEQCQGFLNELI
PTGIADLFFFDGEKIAELAEDESGSVLKTAVRRLLGLDVIAKLKSDLNIFLKKQGAGALSQSLKEEMDNL
ENIRIKHEREADKLRFEAENEVYKQIIHTSSDIQILENKLSQNGGAWAKTREDEQHKVENLLKEKVELEK
QIRMEMETNLPFSLAPKAMQRLQTQIKQEQQVKKKQNFGNELDAFLETLCSKYPSFDTEMAQNAIADSFK
EHVGEFDSTELLLDISDRQANTIDYQLSNLSQDSFSRFDKARVRLSKVEEEIDNASNNIARAPEQEQVQE
LFADVRALDKKKEKLIIEYHDLLEKAKQELRLALETARKIQKLHDKNKDQSSKDQSVSNAQNSILLLEKF
GEQLTKARVNQLENEFVQSYKKLARKEDLQLTASINPATFDVELVDEHGIKINRKAMSAGEKQIYAISIL
EALGRTSGRKLPIIIDTPLGRLDSHHRDKLVENYFPTASHQVVILSTDTEIDRNYTNLIQDDIARTYEIC
FDGTTKASTLKEGYFWKESIKEAM