Protein information:

HomologueDndE
OrganismVibrio fischeri MJ11
Locus tagVFMJ11_A0168
PID2089
GID1089
length115 aa
DEFINITIONDNA sulfur modification protein DndE
gi  197337635
other link: YP_002157725.1
SequenceMLPNRMNLTRSTEEQLKKLKGYTGITPNVSARIAFFRSIESDFRYQGQEAKLDGSLVLDKYTWLGETSDV
TELMLKMYYPEFDTKEYQQAWAAHVEDGIAALRNHKNLLGLSINL