Protein information:

HomologueDndB
OrganismCitrobacter koseri ATCC BAA-895
Locus tagCKO_03498
PID2094
GID1094
length361 aa
DEFINITIONhypothetical protein
gi  157147695
other link: YP_001455014.1
SequenceMHDRNQTNYFYMFPAVRGMQAGREFYIATCPLLTIPKIFSFDEEEVPPELRAQRSLNKARIPDMVRYLLD
NPDNYIFSALTASVAVDVHFEAINDAGSLGTLQVPMGAQILINDGQHRRKAIEEALKANPELGYDNIPVL
FFVDRGLVRSQQMFADLNKYAVRPSPSLATLYDHRDPSAQLACHLAENIEPFIGFTEMEKSSISSLSNKL
FTLSSIKQATKALLGKGLKDLYSDDEKHKAERFWRAVFGVMPEWQMVRRREISPASMRQEFIHSHGVGLQ
AIGLMGKGLLQHSPYNWEQKLEGLRDIDWRKANPEWLKRTMLHGKISKSAISIHLTSNALKQKLGIPLNS
EEQKLEEQLKS