Protein information:

HomologueDndC
OrganismCitrobacter koseri ATCC BAA-895
Locus tagCKO_03497
PID2095
GID1095
length544 aa
DEFINITIONhypothetical protein
gi  157147694
other link: YP_001455013.1
SequenceMSHLLQAYDLDSYEDFINQETFAGRPLHEFVSEIQRIYLADKRPWVIGYSGGKDSSAVTTLIYLALLGLS
PEQRNKPVFVVCSDTLVETPVVVNLISRTLKLIERGARQDGLPILVQQVVPKTHETFWANLLGKGYPAPT
RQFRWCTERMKINPVSDFIRDKVSQFEEVIVVLGSRSAESASRAQVIAKHKIDGTRLARHTTLANAFIYT
PIDTWGVDDVWKLLRGAFRYSSDVTEWETPWGGGNNLPLWTLYMDSSGQGECPMVIDDSTPSCGNSRFGC
WTCTVVTKDRAMESLVQNGEQWMAPLLEFRNMLAKTTEPEEKDKYRNFKRRTGKVSYQYLKEGEDISVER
KHVPGPYLLKYRQEWLEKLLNLDKVLKAQGHDIQLITEGELHAIRQEWLNDPNEPDWNDSLPKIYKRVYG
HDLAWQIDERVRFAGADAGLLHELATEHGIVPEMVMKLIDLEISFEGMGRRQNVQKKVESILQQDWGTFE
EIKEKYSSVQKKNQFDMLLKEKEDIELALDDLSNDFDRLENILNSVTSNDEVAK