Protein information:

HomologueDndD
OrganismCitrobacter koseri ATCC BAA-895
Locus tagCKO_03496
PID2097
GID1096
length115 aa
DEFINITIONhypothetical protein
gi  157147692
other link: YP_001455011.1
SequenceMLPNRLQLNIRVEDQLKRLKASTGVNPNISARIAFFRSVESGYRFDGNDYKTDGNMSMDKAVWLGDTGVA
TELILKMLYPNFDGKKMMQAWAAHVDDGSASLRNHRELISFTTSL

HomologueDndE
OrganismCitrobacter koseri ATCC BAA-895
Locus tagCKO_03495
PID2097
GID1097
length115 aa
DEFINITIONhypothetical protein
gi  157147692
other link: YP_001455011.1
SequenceMLPNRLQLNIRVEDQLKRLKASTGVNPNISARIAFFRSVESGYRFDGNDYKTDGNMSMDKAVWLGDTGVA
TELILKMLYPNFDGKKMMQAWAAHVDDGSASLRNHRELISFTTSL