Summary Sequence Alignment 16S rRNA Context  

12 homologues found:

HomologueDndA
OrganismStreptomyces lividans 1326
Locus tagSLG80
PID2001
GID1001
length397 aa
DEFINITION conserved hypothetical protein
gi 145244345
other link gb: ABP49156.1
SequenceMTYGTCRLTLKGGLGSMVTYLDAAATTRVDQRVADIVLHWMTAEFGNAGSRHEYGIRAKRGVERAREYLA
STVSAEPDELIFTSGATESNNIALLGLAPYGERTGRRHIITSAIEHKAVLEPLEHLAGRGFEVDFLTPGP
SGRISVEGVMERLRPDTLLVSLMHVNNETGVIQPVAELAQQLRATPTYLHVDAAQGYGKVPGDLTTPIDM
ISISGHKIGAPKGVGALVTRRREEMDDERVPLEPIMFGGGQERKLRPGTLPVPLIMGLAEAAKIFEAEHA
QWQVAAQDLRSRLLAGLASTSFQVNGDQDHVVPHILNLSFEDVDAEAFLVTLKDLVAVATGSACTSASFT
PSHVLRAMGLPEEAASKSLRFSWTPGQATDLDVEELARGVAKLKPSY

HomologueDndA
OrganismStreptomyces avermitilis MA-4680
Locus tagSAV_2933
PID2002
GID1002
length384 aa
DEFINITION L-cysteine desulfurase (pyridoxal phosphate-dependent)
gi 29829475
other link ref: NP_824109.1
SequenceMSAVVAYLDVAATTRVDPRVAEVVLHWMTEDFGNAGSRTHEYGARAKKAVQQARSYLADTVGAKTEEVIF
TSGATESNNIALLGLAPHGERTGKKHIITSAIEHKAVLEPLLHLAETRGFTVDVLEPGASGRITVEQVME
HVRPDTLAVSLMHVNNETGVIQPVAELAERLRSTPTYLHVDAAQGYGKIAGDLTAPIDLISISGHKIGAP
KGVGALITRRRGWDKAPLEPIMFGGGQERKLRPGTLPVPLIMGLHEAARIFHESRDNWEREARAMREQIL
EALGKTRFRVNGDQAHTVPHILNVSFDQLNAEALIVRLKDQVAIATGSACTSASYTPSHVLQAMGLPDDV
AANGLRFSWFPPQARDFDPLPIAETIARMQPQEG

HomologueDndA
OrganismPseudoalteromonas haloplanktis TAC125
Locus tagPSHAb0099
PID2003
GID1003
length375 aa
DEFINITION Cysteine desulfurase (ThiI) (transpersulfidase) (NifS protein homolog)
gi 77362020
other link ref: YP_341594.1
SequenceMTTYLDMNATAPVLKEVADLVRKMFLDEYGNAGSRTHEFGTNAKKSVEKARKQVAEVVDADKSEVIFTSG
ATESNNIAILGLREFGEQESKKHIITTRIEHKAVLEPIEYLFKNGFEVSFLEVDESGVVDSAELKNLLRK
DTLLVSIMHVNNETGSIQPIIDICDVLELHEAFLHIDAAQSFGKLSDDLKCKRIDLISVSGHKVYAPKGV
GALVMRKRGFMKPPLKPIMFGGGQEKGLRPGTLAVPLIAGFGLACEIAQKNSTAWQKHAQSLKDDLIAAL
NTLDAQYNGENTSPFVLNFSVPGINSEAAMVMLKGIAAVSNGSACTSSSYTPSHVLTAMQLDEKRIAGAI
RVSWGHMTESLPITEIIEKLEQLKL

HomologueDndA
OrganismBacillus cereus E33L
Locus tagBCZK0830
PID2004
GID1004
length376 aa
DEFINITION probable cysteine desulphurase
gi 52144395
other link ref: YP_082434.1
SequenceMISMLYLDNSATTQLLPEVKEVMLPYLLEEFGNPSSKYYGLAQNAKDAVETARKHVAQLLGCETDEVIFT
SGATESNNFILKGIAHYHKDKGNHIITSKVEHPSIIETCKFLEANGYTVTYLDVDQYGRINLEELTKAIQ
QEKTLLVSIMWGNNELGSLNQINEIAKICKENEIFFHTDATQVVGKIQFSLSDIDGINFLSCSSHKFHGP
KGIGVTMIGKDNLGLPIQITPLLHGGGQERDLRSGTLPVHNIVGMGKAAEIAYLNLEQNIYKLEQLENKL
ADILKTKFQNHIEFNNDIQDKIPGILSVIFKGVNNETLVRTLAPVAAVSTGSACSSSKPSHVLQAIGLSM
DDLRSTIRFSLSSTTSLEELDVFNNL

HomologueDndA
OrganismGeobacter uraniireducens Rf4
Locus tagGura_2472
PID2005
GID1005
length377 aa
DEFINITIONaminotransferase, class V
gi 148264517
other link ref: YP_001231223.1
SequenceMGTIYLDCNATTPLDAEVREVMLRYLTEDFGNEGSRTHEFGARAKQAVQKARDQVAAVVSAKRDEVIFTS
GATESNNLAILGLRAAGEEQGKKHVITTAIEHKAVLEPCDALERAGFAVTRVPVGAGGVVELEAIKAALR
PDTLLVSVMQTNNETGIRQPLDDIAEILKNHPAYFHTDAAQGFGKDLELLRNLRIDLISISGHKIYAPKG
IGALVMRRRGYERILLQPLVYGGGQERGLRPGTLPVALIAALGTAAEIAVRDNEKRREACRCMRENALKA
LSPLEPKLTGEQSLAMDHVLNLAFPGLDSEALIVALKDLIAISNGSACTSSNYTPSHVLKAMGMSDDEAN
ACVRLSWCHMTTEIDWDAVACRISSLR

HomologueDndA
OrganismCandidatus Pelagibacter ubique HTCC1002
Locus tagPU1002_00495
PID2006
GID1006
length378 aa
DEFINITION cysteine desulfurase
gi 91763091
other link ref: ZP_01265055.1
SequenceMSIYLDCNATSPIEPEVVEKLTQYLTIDFGNEGSHTHEFGSTAKKAVQEARDNIVSLVDASRNEIIFTSG
ATESNNIAILGLKEFGIKNNKKHIITSTIEHKAVLEPIEELKKLGFEVDVLPVDKSGRVNPKDIQKKLKE
ETLLVSIMHVNNETGIIQPIEEICKVIENNDCFFHVDGAQGFGKEIDTLKNKRIDLISISGHKIYGPKGI
GALITRLRNYNKPPLQPLFFGGGQESKLRPGTLPVHLIAGLGVAAKVAKRDLKKRQTKNKVIFDKIMDLI
KNLKGELNGDTKHLLGNCINFSIPGVDAEAFMLMTKELISISNGSACTSSTYEPSHVIKSMTNNEDKIRG
ALRFSWCHLTDNKIPVEEIEKKLQNILY

HomologueDndA
OrganismRoseobacter denitrificans OCh 114
Locus tagRD1_0802
PID2007
GID1007
length387 aa
DEFINITION cysteine desulfurase
gi 110678159
other link ref: YP_681166.1
SequenceMSAPIYLDHNASTPIDPEVLETVIRVSRDVYANPSSVEHSQGSGAARVVDTARAQIAGHLNCKETELVFT
AGSTEANNLAILGAFPRLKEAGRTHLITSKIEHPSVLACFDHLESQGARVTRLGVDEGGQISLDELALSL
TDETGFLSIMAANNETGVLQPILEAGQLAEEAGALFHTDFSQASAFVPLDLKNAPIHLASFSGHKAYGPK
GVGALYRSIRKPRVNLAPVMFGGGQEKGLRAGTLNTPGIAGLGHAFELISKNIDHDRDRIGALRDQLEIE
LKETLAAQVNGNTAARLPNTMSLTIDGVVPQALMQKLRNDVCFSASSACATEHVETSHVLLAMFGDTPRA
RNAFRLGLGRQTSKKDISKVIRLFLQASSELLLLKTA

HomologueDndA
OrganismMesorhizobium sp. BNC1 plasmid3
Locus tagMeso_4569
PID2008
GID1008
length388 aa
DEFINITION aminotransferase, class V
gi 110347355
other link ref: YP_666171.1
SequenceMASPLYLDHNATTPIDPAVVAAMEPFLREIFGNPASVEHAHGHAAGLAVDRARAQVAEALGAQPKEIVFT
GSCTEANNLAILGVARAHPNKKHIVTTAIEHPAILEPARALERDGWRVTYAPVDEAGRVSVDAIADAITD
ETTLVSVMAANNEVGTLQPIRAIGELCEARGVLFHSDLAQVVAYGTVDVERDHIHLASLSAHKAYGPKGI
GALYIRSRKPKARVAPIFFGGGQERGLRPGTLNTAAIVGMGEALAIARRCAQADGVRLRAMCNLFRDRLQ
TSLPGVKLNGHPAERLANNLSFSIEGVEPLALIRNLRADLSFSAASACATDKIETSHVLKAMFGDTGRAR
TAFRIAPGRHTSQADMDCALDLILAEAGILSSFARPAA

HomologueDndA
OrganismCandidatus Methanoregula boonei 6A8
Locus tagMboo_0356
PID2009
GID1009
length390 aa
DEFINITION aminotransferase, class V
gi 154149901
other link ref: YP_001403519.1
SequenceMEKINRPIYMDSHATTPVDPRVLEAMLPYFSDIFGNAGSIDHAYGAVAAEAVKKAREQCAHPLNAHPEEI
IFTSGATEANNIAILGTAEQYAEKGDHIITCVTEHKAVLDTCKHLQKTGKSVTFLPVDQYGLVDPGQVED
AITDKTVLISIMTANNEIGTIAPIKEIGKIAHEHGVIFHTDAAQAVGHISIDVKEMNIDLLSFSGHKIYG
PKGIGGLYIRGSNPRVKLAPIVFGGGQEKGLRSGTLNVPGIVGLGKALAVAEKEMAKEEKQYRKWTTQMF
DAFKDAYPSVMLNGHPTKRLAHNLNVCFPGIESKALIHLLKDDVSISAGSACTTTSVEPSHVLLAIGRTE
EESHWAVRFGLGRGNTEEIIEYTIITLKDDLNKIKKISDI

HomologueDndA
OrganismMycobacterium abscessus ATCC 19977
Locus tagMAB_1093c
PID2098
GID1098
length399 aa
DEFINITIONputative L-cysteine desulfurase
gi 169628187
other link ref: YP_001701836.1
SequenceMTVDTPTDNPTQLRFSDKETAGRVVYLDSNATTPVDPRVADEVLTYMAREFGNAGSRTHGYGQVAKERVA
RAREQVAEVVRAQPDDVIFTSGATESNNLAILGLAPSGEKANRRHIVSTQIEHKAVLEPLAILTDRGFEV
TLVPPTRGGRIEPSAIADAVRPDTLLVSTMAVNNETGVIQPIPEIAEVLAPHDAYLHVDAAQAFGKIIEP
LRNSRIDMLSVSGHKVFAPKGIGALVARRRGYRRVPLQPLMFGGGQERGLRPGTLPVALIAGLGLAAELA
LKENDARARHALALKHQALNALSELGIQANGDEEHTVPHTLNFSVPGVDAEAAIVALKEVVAISNGSACT
SQKYEPSHVLVAADLPKKQIDGALRFSWSHLTGEVPWDVVAQRLAQLVT

HomologueDndA
Organismgamma proteobacterium NOR5-3
Locus tagNOR53_2472
PID2127
GID1127
length392 aa
DEFINITIONcysteine desulfurase DndA
gi 219674928
other link gb: EED31295.1
SequenceMRTKHATSILRVSSKFMDQYLDTNATAPIEPEVAEIVIHYLTQEFGNAGSRTHEYGSRAKKAVELARSQI
AKVIDCDRSEVIFTSGATESNNLVILGLRAFLEESSKRHLITAATEHKAVLEPMQHLEAGGFELTVLPPG
PGGYVLPSDLERALRPDTGLVSLMQVNNETGVEQPLSEYAAVLAEHDCYFHTDAAQGFGKSISPLTNSRV
DLISVSGHKIYAPKGVGALVARRRRYKMPPLKPLMYGGGQERGLRPGTAPVALIAGLGKASELALEHHAR
RAQVNLRIRQDALAALSDLGPVMHGDQTRVLSHVLSFSVPGVNSEAALIGLKGIAAVSNGSACTSASYEG
SHVLKAMGLTEDEVFGALRVSWSHLGAPPDWSDFAAALATLQ

HomologueDndA
OrganismAcidobacterium capsulatum ATCC 51196
Locus tagACP_3187
PID2131
GID1131
length378 aa
DEFINITIONcysteine desulfurase
gi 225874733
other link ref: YP_002756192.1
SequenceMPPIYLDCNASTPIDPAVFDAMRPWLVNDFGNSSSRTHEFGLKAKRAVALARKQIASAFGVDQEEVVFTS
GATESNNLAILGLASWGEQTGRKHLITSAMEHSAVLEPIAWLRDNAGFSVTELPASSDGIIDPDDLRRSL
RPDTALVSLMQVNNETGVIQPLRELAIVLTDHPAYFHVDAAQGFGKEFTEISARRIDLISCTGHKIYGPQ
GIGALVVKRTHERPIPLKPLTFGGGHERGLRPGTLPTHLIVGFGSAASLAVADHKARESKNRSFRKQLFE
GLDGLPLTTHGAPNLVIPHVTNLSIDGVSSEAAMVALRQYIAISNGSACSSAKYEPSHVLRAMGLSNEQL
DGAMRFSWCHLTPEVDWRAVRALLAEFL