Summary Sequence Alignment 16S rRNA Context  

32 homologues found:

HomologueDndB
OrganismStreptomyces lividans 1326
Locus tagSLG79
PID2010
GID1010
length312 aa
DEFINITION conserved hypothetical protein
gi 145244344
other link gb: ABP49155.1
SequenceMNKGRLPALTRYLVDNPTDYVFSALTASVDGDMRFEGIADSGVGMRAGQIVISMAARFLINDGQHRRAAI
EQALKENPDLGEETIAVVFFHDAGLARCQQMFADLNRHAVRPPRSIGVLYDHRDDLATTVRLLAMRAPVF
KGFVEMESSTLSQRSRKLFTLSSVYYATQSLLQGLEITKDQSRELAEAYWAAVDAVIPEWKLVRRRELSA
QDVRRDYLHTHGIALHALGRVGNSLLRKSLAPRSWTPALKRLSSVDWSRANTDWEGRALVGGRVSKSHQN
LTLTVNYLRQHLKLELSAEEQRAEDAYLRGES

HomologueDndB
OrganismStreptomyces avermitilis MA-4680
Locus tagSAV_2932
PID2011
GID1011
length379 aa
DEFINITION hypothetical protein SAV_2932
gi 29829474
other link ref: NP_824108.1
SequenceMQTEAASKTAGRAATRASTGFEYTFPAIRGVQAGREFYASMCPLRLIPKIFLFDEDDLSAELRAQRVLNK
GRLPALARYILDNPDDYVFSALTASVDGDMAFECQGAEGSAHRTGQLRIPMDARFLINDGQHRRAAIELA
LKEKPDLGDETIAVVFFHDTGLSRSQQMFADLNRHAVRPARSIGVLYDHRDLNAQITRALTERSAIFKGF
VEMEKSTLSARSRKLFTLSALYYGNQSLLQGLDLKQDEAIKLTQSFWEAVDTALPEWAMVRGKQLSAQEM
RRDFIHSHGIALHALGRVGNALLRESVKEAAWKRRLVPLTDVDWTRGNIDWEGRAIVGGRVSKSHQNVTL
TVNYLRKHLGLELSPEERRVEDAYLRGEA

HomologueDndB
OrganismPseudomonas fluorescens PfO-1
Locus tagPfl_0738
PID2012
GID1012
length375 aa
DEFINITION hypothetical protein PflO1_0738
gi 77456965
other link ref: YP_346470.1
SequenceMLKSSGMTSPFSYTFPAIRGVQAGREFYVSMCPLRLLAKLFVFDNEELMPELRAQRSINRTRVPEIARYI
LSNTDSYTFSAITASIDGKVGFEPVGTNDTTHFRMGTLTVDMDAKFVVNDGQHRRAAIEQALEERPELGD
ETIAVVFFHDRGLERCQQMFADLNRHAVKPSPSLSVLYDHRNAAASVAKHLGLTSRVFRNLVESERSSLS
KRSRKLFTLSALHFAILEMLSAKDLEDFTWASKRCNEFWEVVGEQIPEWTHVRESRMTAGEVRQDFIHSH
AIVLQALGRVGKFVYRTADGRPDLKSALKNLRDIDWSRTNSATWEGRAMIGGRMAKNSQNITLTCNQIKF
SLGLGLTPEEQVIEDAFLAARQATS

HomologueDndB
OrganismPseudoalteromonas haloplanktis TAC125
Locus tagPSHAb0098
PID2013
GID1013
length363 aa
DEFINITION putative protein with thiol (cysteine) protease domain
gi 77362019
other link ref: YP_341593.1
SequenceMNQIVSGTSFPAIKGMQAKTEYYIVMCPLKRLSKIFTLDEGQLPVNQRAQRIINEERIPDIANYILDSRD
NYVFSALTACIDGLSEFIGIGESKHEQKIGTLVIDEDAEIYITDGQHRNAAILEALKADPTLADETISVV
FFTNKSLEERQRIFKDLNLYPVKTDSSLSITYDDKPDAILSKTIIFRSEQFTKLVHMEKSNLGPRSKKLI
SHSAVNKASKYLLGTITKNNYESLIPVAFEFWHEVLKNMPAWQLVCDDKASGGELRDESIHAHAVTFHAL
GLLGFHLLNNDPKWQSKLKGLQKINWSRNSINWSGRCVINNSMTNNRKAAELTCIQIKSHLNIPLTDKEQ
LVEKTFKEARNGY

HomologueDndB
OrganismEscherichia coli B7A
Locus tagEcolB7_01003586
PID2014
GID1014
length365 aa
DEFINITION hypothetical protein EcolB7_01003586
gi 75228090
other link ref: ZP_00714765.1
SequenceMDYSMASVDADYCYSFPAIRGIQAGRPFYIATCPMRIIPKIFSFDENDVPPELRAQRTLNKSRIPEMVRY
LLENPKDYVFSALTASIAVDVQFDEFPGSNNLGTLCVPMDAQILINDGQHRRKAIEDALDARPELGQDNI
PVLFFVDEGLKRSQQMFADLNKYAIRPSPSLASLYDHRDACSNLARYLAMSVEPFVGMTELEKSGISQRS
NKLFTLSSIKQATRALLGKDPKEDNFEECTHIATQYWQAIFSVMPDWQLAAKKEVSPVQLRQDYVHAHGI
GLQALGQLGYTLLTDYPEQWPEKIAALKTFNWRRNNPDLIKRAMQHGKLSKTSTAIQLTCNALKTALSIP
LTPEEQELEAQMVVS

HomologueDndB
OrganismHahella chejuensis KCTC 2396
Locus tagHCH_07042
PID2015
GID1015
length366 aa
DEFINITION hypothetical protein HCH_07042
gi 83649647
other link ref: YP_438082.1
SequenceMVSSLLNEYTHKFPAVRGMQAGRPCYIAMCPMRLIPKLFVFDEDVVPPELRAQRRLNESRVPDITHYLVE
NPDSYTLSAITASIDGSVIFEPVADTGPAINLGMLSIGMDTQILVNDGQHRRKAIEQAVKEAHELGHDNI
PVLFFVDEGLTRSQQMFADLNKHAVRPSDSLSTLYDHRDGGSKLARYVFECVPCFKSLTDLESSSLSKRS
SKLFTLSSLKQASKALLGKRGKDPISEPEMQLACEYWEAVCSNMPHWHDALERNISTSDLREQYIHAHGI
GLGALGEAGSDLLRQFPNNWKDKLTHLSEIDWSRSNIKQWRGRAMDNHGKISKTRSSTVLTANIIRHALG
VSLGAEQQHIEDQLTS

HomologueDndB
OrganismOceanobacter sp. RED65
Locus tagRED65_14677
PID2016
GID1016
length365 aa
DEFINITION hypothetical protein RED65_14677
gi 94499775
other link ref: ZP_01306311.1
SequenceMVKTLIKEYSHSFPAVRGMQAGRPCYIAMCPMRTIPKIFVFDEDEVPPELRAQRTLNKTRIPEIAEYLIS
NPNDYTLSAITASVSEQVHFEPMADTGPGINLGMLTVSMDAQILINDGQHRRAAIEAAIREAHELGHDHI
PVLFFVDEDLKRSQQMFADLNKYAVRPNESISTLYDHRDPLSDLARHVVKNVDCFKNLTEMEKSSLSNRS
SKLFTLSSIKLASRALLKKGPKESVSDKEKELATEFWTEVCENIKDWQDAKSKKVSTADLRQNYVHAHGV
TLQALGSAGADLLAQKPKAWRKHLNKLGTIDWSRSNTGIWEGRALMYGKLSKARANVMLTSNLIKQHMGL
NLSPESQEYEKQFKS

HomologueDndB
OrganismBacillus cereus E33L
Locus tagBCZK0834
PID2017
GID1017
length364 aa
DEFINITION hypothetical protein BCZK0834
gi 52144388
other link ref: YP_082438.1
SequenceMDYGFSYNFPALRGKQGGKEYFVVMCPLRLIPKIFLFDEEEIPAEHRAQRILNKIRIPEITNYIIENQND
YVFSSLTASIDGDIEFQPFSSDQSFQDLGQLRISLDSKFLINDGQHRRAAIEEAIKLSPELGHETISVVF
YHDQGLRNSQQIFSDLNRHAVNTTSSIGILYDHRDKLALVTKEIVEENELLSRYTDKEKVNLSKNSPKIL
ALNHIFNTNLRLLGKTKGDLITEKEEQFLKEFWNILCDTIVEWNLVYKKELNPRELRMHYIVGHGVFIES
VGLVGKYVFENHPKDWKKYISLLADIDYSRSNSSDWLGRAFNTNGRIQKTKETVTLTANKLKEKLGLPLT
EGEQKIEEKFQLGA

HomologueDndB
OrganismGeobacter uraniireducens Rf4
Locus tagGura_2473
PID2018
GID1018
length358 aa
DEFINITIONhypothetical protein
gi 148264518
other link ref: YP_001231224.1
SequenceMDTNSTLSFPVIRGLQAHREYYVAMWTLRMMRQISIFNEDELPPELRAQRILNKARIPEIAEYIIDNPDD
YVFSALTVSIDSDVLFEPLPGQDKLGLLRVPMDAHFIINDGQHRRAAIIEALKQRPELEHETIAVVFFLD
IGLERCQQMFADLNRYAIRPSRSLGLLYDHRNDKARLAKMVIMKSEIFRDLVDMEKSSLAPRARKLFTLS
AFYNACADLVNGLATGNLIEDADLARTFWEETAKHFPMWEQVREGKLPASEVREGFIHSHGIALQAIGKA
GNALLHSHPNDWKKRLKALEKIDWSRNNAKIWEGRAIIGGKVSKSTTNVVLATNVIKKALSLSLSEEEQR
VETAHLKK

HomologueDndB
OrganismCandidatus Pelagibacter ubique HTCC1002
Locus tagPU1002_00500
PID2019
GID1019
length361 aa
DEFINITION hypothetical protein PU1002_00500
gi 91763092
other link ref: ZP_01265056.1
SequenceMSLNVHKFAAIKGRQSGDDYFTVVCEMSIIPRLFLFNEATIPTELRAQRHINKTRIPEMARYMVDNPKNY
IFSALTASIDGNISFKPLKLNGKDSEIGELEIAGDAKLMINDGQHRRAAIEKALTENPDLANDTISVVFF
KDKGLKKSQQMFSDLNRHAIRPATSIARLYDHRDPIAEVIRRVVYETEVFKGVVEMERSNIAERSSKLFP
FSGIYSASKYLINLEDKKKIEQIVTLVSSFWDNVGQQFDQWRGVRIGNISATEVRRDYIHTHVVMLQALG
IAGKDLIKANPTNWKAKLKNLKKIDWLKSNPIWDRRVLNNGRVVKNSNSIVLASNVIKKAFGVTLNVNEK
ALESKFKKNGK

HomologueDndB
OrganismRoseobacter denitrificans OCh 114
Locus tagRD1_0798
PID2020
GID1020
length368 aa
DEFINITION hypothetical protein RD1_0798
gi 110678155
other link ref: YP_681162.1
SequenceMSGNFYNFAAIRGVQAGTEYYVIMVPLKMVPKIFEFDSQELPADLRAQRVLSNVRVPQIASYLSENFEEY
TLSSLCASVDGDLEFSPASDGLQFRNVGELRLSMTARIILNDGQHRRAAIEEALKTRPKLENETISVVLF
LDEGLERCQQMFADLNKNAVRPSGSLNVLYDRRNPLARLSTRVLEDIPFFQEFTELEKTSLSNRAKNLFT
LSSLNQANKWLAGQDADRFGENTESTVIAYWRQVSEVIPDWQKLMRGATTAGDLRKETVHAHGVMLQAFG
VLGARLITAKPDGWAETLAPLAEINWSKRNAQLWRPRVMGARGMDGSVKSVHLAANVLVAAVGLPLNEKE
QANEDDYLASLAEEKVVA

HomologueDndB
OrganismMesorhizobium sp. BNC1 plasmid3
Locus tagMeso_4573
PID2021
GID1021
length370 aa
DEFINITION hypothetical protein Meso_4573
gi 110347359
other link ref: YP_666175.1
SequenceMDGNSLDFTAIRGVQAGSAYFVIMVPLKVVPRLFKFDDEAMPAELRAQRVLNRARVPAIAAYITNNASEY
ILSSLCASIDGEIEFEPAATEGPLRAVGKLRIAMAATILINDGQHRRAAIEEAIRERPLLGDETISVVVF
ADRGLKRSQQMFADLNIHAVRPTKSIKLLYNHRDALAALSRDVVAAVPLFRDFTCYDSSSISNRSIKLFT
LSSLHQATAEVIGKSGAGQVEPDDKDKAIAFWTAVIANMPDWQRVGTRDVASYELRRDYIHAHGVAVQAI
ATAGAQLMKSVPKAWPARLAKLRTIDWSRANRALWDNRALVAGKVNKSKNNVTLVTNVVVTALGLPLSAE
AQRIEDLYAPSTEARLKVAS

HomologueDndB
OrganismVibrio cholerae MZO-2
Locus tagA5A_0794
PID2022
GID1022
length359 aa
DEFINITION DNA sulfur modification protein DndB
gi 153824622
other link ref: ZP_01977289.1
SequenceMHNQDSGYCYSFPAVRGIQAGRPFYIATCPLRIIPKIFSYNEDDVPPELRAQRTLNKTRIPEMVRYLLDN
PKDYVFSALTASVGIDICFEDHDGAPNLGILKIPMDAQILINDGQHRRKAIEEALRENPDLGQDNIPVLF
FVDEGLKRSQQMFADLNKYAVKPSPSLGVLYDLRDESSELARRLATHCMPFIGLTEMEKSNISPKSNKLF
TLSSIKQATRALLGKGAKDGFTKEEKALAESFWKIVAENMPDWQMVISKQVSPAQLRQEYIHAHGVGLHA
IGVMGNSLLCEEPEKWAEKLKKLRNINWLKTNPEWIKRSMNLGKVSKSTLNIQLTANYLKISLALPLTPE
EKALEKQLS

HomologueDndB
OrganismVibrio cholerae MZO-3
Locus tagA51_B0787
PID2023
GID1023
length359 aa
DEFINITION conserved hypothetical protein
gi 153800612
other link ref: ZP_01955198.1
SequenceMHNQDSGYCYSFPAVRGIQAGRPFYIATCPLRIIPKIFSYNEDDVPPELRAQRTLNKTRIPEMVRYLLDN
PKDYVFSALTASVGIDICFEDHDGAPNLGILKIPMDAQILINDGQHRRKAIEEALRENPDLGQDNIPVLF
FVDEGLKRSQQMFADLNKYAVKPSPSLGVLYDLRDESSELARRLATHCMPFIGLTEMEKSNISPKSNKLF
TLSSIKQATRALLGKGAKDGFTKEEKALAESFWKIVAENMPDWQMVISKQVSPAQLRQEYIHAHGVGLHA
IGVMGNSLLCEEPEKWAEKLKKLRNINWLKTNPEWIKRSMNLGKVSKSTLNIQLTANYLKISLALPLTPE
EKALEKQLS

HomologueDndB
OrganismEnterobacter sp. 638
Locus tagEnt638_0472
PID2024
GID1024
length361 aa
DEFINITION hypothetical protein Ent638_0472
gi 146310137
other link ref: YP_001175211.1
SequenceMANVDADYCYSFPAIRGIQAGRPFYIATCPMRIIPKIFSFDENDVPPELRAQRTLNKSRIPEMVRYLLEN
PKDYVFSALTASIAVDVQFDEFPGSNNLGTLCVPMDAQILINDGQHRRKAIEDALDARPELGQDNIPVLF
FVDEGLKRSQQMFADLNKYAIRPSPSLSSLYDHRDASSSLARYLAMSVEPFVGMTELEKSGISQRSNKLF
TLSSIKQATRALLGKDPKEDNFEECTQIVTHYWQAIFRVMPDWQLAAKKEVSPVQLRQDYVHAHGIGLQA
LGQLGYTLLTDYPEQWPEKIGALKTFNWRRNNPDLIRRAMQHGKLSKTSTAIQLTCNALKNALSLPLTPE
EQELEAQMVVS

HomologueDndB
OrganismShewanella pealeana ATCC 700345
Locus tagSpea_2305
PID2025
GID1025
length369 aa
DEFINITIONhypothetical protein
gi 157962126
other link ref: YP_001502160.1
SequenceMKSPQDGYCFSFPAVRGIQAGKPFYIATCPLSTIPKIFVFDEEEVPPELRAQRTLNKSRIPEMVRYLVEN
PKDYVFSALTVSVASTVIFEESDHNNTPNLGTLKVPMDAQILINDGQHRRAAIEAAIKEQPEIAHDNIAV
LFFVDEGLKRSQQMFADLNKYAVKPSPSLAALYDSRDESAELARYLAQNVKPFEGFTEMEKSSISSKSGK
LFTLSSLKQANRALLGKGVKDSFTEEEKQLAADYWQAVFAETPEWQMVINKELSPSQFRQEYVHAHGVGL
HALGALGCSLITAQPDVWKETIKQLKNVDWRKSNPVWANRSMLHGKLSKASTNIMLTTNALKQSLSLSLT
PEERALENKHIPSSEASNG

HomologueDndB
OrganismCandidatus Methanoregula boonei 6A8
Locus tagMboo_0360
PID2026
GID1026
length380 aa
DEFINITIONhypothetical proteinin
gi 154149905
other link ref: YP_001403523.1
SequenceMKVAALDEVDDLETAVFSFPAIRGTQAGREYYSAMVQLKLVPTIFRFNESEVPAQVRAQRVLNHARIPEI
AHYIISNPHDYVFSSIAASISEVPVKFVPAPQDNPNSRVGKIIIPMGARVLINDGQHRRAAIESALKERP
ELGNETISVVFFIDTGLKRSQQMFSDLNRHAVRPTKSISILYDSREAFAQSVRDIATSLPIFKDLTEFEK
TSISNRSRKMFTLSTIYQATAALLGKKTKVKKITNDEEKLASKYWNIVADNIPEWQQLIRGDVASSSLRN
DFIHAHGIALHALGLAGHALIEEYPDTWEEKLENLHKIDWSRSNAEVWEGRAMNNGTISKSQMNLALTTN
YLKYILTLPLTKEEEKNEKKYQTQVRGKLR

HomologueDndB
OrganismBurkholderia ambifaria MC40-6
Locus tagBamMC406_0012
PID2027
GID1027
length375 aa
DEFINITIONhypothetical protein
gi 172059078
other link ref: YP_001806730.1
SequenceMAENFSYVFPAIRGVQAGREYYVSMCPLRLLPRLFTFDEEELVPELRAQRTLNKARIPDIARYIVENKAS
YTFSAITVSIDGSIQFEPVGPEGPAKFRMGSLTVSMDAKFIVNDGQHRRAAILQALEAAPELGEETIAVV
FFLDRGLERCQQMFADLNRYAVKPSASIGVLYDHRSVAASLARHMSLTSPVFKNLIETERSSLSPRSRKL
FTLSAINFANTELLLEKELEDFGSASEKCLEFWESVGAQIPEWNYVRQAKMTSGEVRRDFIHSHAIVLQA
LGRAGRSLYQLSSSERMKRIKRLRSVDWSRQNVTTWEGRAMIGGAMAKSGQNITLTCNEIKRVLGLGHTA
EENAAEAALQASRSPQRGAHRKAKK

HomologueDndB
OrganismSalmonella enterica serovar Saintpaul SARA23
Locus tagSentent_010100006030
PID2077
GID1077
length361 aa
DEFINITIONhypothetical protein
gi 167542818
other link ref: ZP_02338394.1
SequenceMASVDADYCYSFPAIRGIQAGRPFYIATCPMRIIPKIFSFDENDVPPELRAQRTLNKSRIPEMVRYLLEN
PKDYVFSALTASIAVDVQFDEFPNSNNLGTLCVPMDAQILINDGQHRRKAIEDALDARPELGQDNIPVLF
FVDEGLKRSQQMFADLNKYAIRPSPSLASLYDHRDASSNLARYLAMSIEPFVGMTELEKSGISQRSNKLF
TLSSIKQATRALLGKDPKENNFEECTQIATQYWQAIFNVMPDWQLAAKKEVSPVQLRQDYVHAHGIGLQA
LGQLGYTLLKDYPEQWPEKIAALKTFNWRRNNPDLIKRAMQHGKLSKTNTAIQLTCNALKTALSIPLTPE
EQELEAQMVAS

HomologueDndB
OrganismVibrio fischeri MJ11
Locus tagVFMJ11_A0171
PID2086
GID1086
length359 aa
DEFINITIONDNA sulfur modification protein DndB
gi 197337419
other link ref: YP_002157728.1
SequenceMNNHESGYCYSFPAVKGIQAGRPFYIATCPLRIIPKIFSYNEDDVPPELRAQRTLNKTRIPEMVRYLLEN
PTEYVFSALTASVGVDISFNEHEGAPNLGILHIPMDAQILINDGQHRRKAIEEALRENPDLGQDNIAVLF
FIDEGLDRSQQMFADLNKYAVKPSPSLGTLYDHRDESSELARLLASSVQPFIGLTEMEKSNISPKSNKLF
TLSSIKQSTRALLSKGAKDGFNDEEKALASEYWQEVTKHIKDWQLVLKKEVSPAQLRQEFIHAHGLGLHA
LGLLGKHLLCQEPNNWKEKLSLLSEVDWRKTNKDWLQRSMNHGKLSKSTTNIQLTTNALKMKLGLTLTPE
EQTLEKQLS

HomologueDndB
OrganismClostridium botulinum E3 str. Alaska E43
Locus tagCLH_1923
PID2090
GID1090
length362 aa
DEFINITIONDNA sulfur modification protein DndB
gi 188587554
other link ref: YP_001921304.1
SequenceMKNNFFYTFPAIKGKQATRDFFIIMCPLKILSKLFIFNDDDLPPEHRAQRILNKARIPEMASYIVNNPKD
YVFSSLTASIDGDFEFSPIDKAFDEKIGTLKVAMDSRLLINDGQHRRAAIEEALKADTEIGDETVSVVLF
IDEGLKRSQQIFADLNKHAVNVSKSIGILYDSRDPIAMITRSLLEKNDYLKHYTDKENPSLSKFSPKLFT
LSSINETNKKLLNKLNTNDPKVISFVNEFWDVLCENMKEWQFVFNKDTNPTLFRKDYISSNGVVLEALGL
VGNYLYKNNSYDWKKILSYIKNIDWHRTNLDDWQNRVIGPTGRIVKSATYVRLTNNLIKVKLNIPLSKDE
QKLENDCKRKVN

HomologueDndB
OrganismCitrobacter koseri ATCC BAA-895
Locus tagCKO_03498
PID2094
GID1094
length361 aa
DEFINITIONhypothetical protein
gi 157147695
other link ref: YP_001455014.1
SequenceMHDRNQTNYFYMFPAVRGMQAGREFYIATCPLLTIPKIFSFDEEEVPPELRAQRSLNKARIPDMVRYLLD
NPDNYIFSALTASVAVDVHFEAINDAGSLGTLQVPMGAQILINDGQHRRKAIEEALKANPELGYDNIPVL
FFVDRGLVRSQQMFADLNKYAVRPSPSLATLYDHRDPSAQLACHLAENIEPFIGFTEMEKSSISSLSNKL
FTLSSIKQATKALLGKGLKDLYSDDEKHKAERFWRAVFGVMPEWQMVRRREISPASMRQEFIHSHGVGLQ
AIGLMGKGLLQHSPYNWEQKLEGLRDIDWRKANPEWLKRTMLHGKISKSAISIHLTSNALKQKLGIPLNS
EEQKLEEQLKS

HomologueDndB
OrganismMycobacterium abscessus ATCC 19977
Locus tagMAB_1094
PID2099
GID1099
length380 aa
DEFINITIONhypothetical protein
gi 169628188
other link ref: YP_001701837.1
SequenceMTQTHTDAQSPTSPVRARTGEFEWAFPAIRGVQAGREYYVTMCPLRLIPRMFLFDEEELTAEMRAQRTLN
KGRVPEIARYIVENSDSYVFSALTASVDVDVRFDPLATDGPSDRVGTLVIPMSARFVINDGQHRRAAIQQ
ALAENPALGDESIAIVLFLDIGLERCQQMFADLNRYAVRPAKSIGVLYDHRDEMSALTRLVVLRSPFLRD
LTEMETSNLAQRSRKLFTLSALHAATKALLDGIEESNFERRVDLASKYWELVIGQFPEWDQVFNREITAG
EVRRDFIHTHGIVLHALGKVGNSLLSQGKGVRSWSPALKKLRDVDWHRASSTWEGRAVIGGRVSKSAANV
LLTTAAMRAVMGLPLPPDEQRAEDVFGGGN

HomologueDndB
OrganismClostridium perfringens NCTC 8239
Locus tagAC7_1516
PID2103
GID1103
length366 aa
DEFINITIONDNA sulfur modification protein DndB
gi 168217097
other link ref: ZP_02642722.1
SequenceMDNNFFYKFPALKGIQASREFFVIMCPLSVLSKLFIFNDDELPPEYRAQRLLNKSRIPEITSYMVDNPND
YVFSSVTASIDGEFSFEPFEKASNENMGTLQVSMDSRLLINDGQHRRAAIEEALKVSPELGKETISVVLF
IDEGLNRSQQIFADLNKHAVNVSKSIGILYDSRDPIALTTKALIEKNKFLKYFTDREQPSLSKYSNKLFT
LSSINETNKKLLCKLDPKDESTQKFVYEFWNCLCTNMKEWQFVFNKEISPSIFRKSYISSNAVILESLGI
IGNCLFRKNKSNWKEYMIKLNEINWNRSNLEDWGNRAIGNNGRIVKNSNYIKLTTNFIKLQLGIKLNHDE
LELENSYRKQKENKNE

HomologueDndB
OrganismExiguobacterium sp. AT1b
Locus tagEAT1bDRAFT_1706
PID2107
GID1107
length366 aa
DEFINITIONconserved hypothetical protein
gi 187605117
other link ref: ZP_02991319.1
SequenceMDPNFSYNFPALRGKQAEKEYFVVMCPLKLIPKIFLFDEEEVPPQYRSQRILNKSRVPDITNYIVDQSKD
YVFSSLTASIDGEIQFTPFTDEPNFKDLGKLSIALDSRFLINDGQHRRAAIEEALKIMPELGNETISVVF
FHDEGLERSQQIFSDLNRHAVNTTSSIGILYDHRDQLSLLTKEIVEEIPLLKRYTEMEKTSLSKNSPKLL
ALNHIYNANKRLINKKKGALLTEEDALNIKTFWLTLCNSIHEWEQVFNKEISPRDLRMISIAGQGLFIEA
AAEVARSLIEQKPDTWTAYLTKFKDIDWSRSNEKDWKGRAFNENGRILKNNYTIRLTAIRIKSLIGIKLT
KEEKDFDQQKSSMNVL

HomologueDndB
OrganismDesulfatibacillum alkenivorans AK-01
Locus tagDalkDRAFT_5059
PID2111
GID1111
length364 aa
DEFINITIONhypothetical protein
gi 163722438
other link ref: ZP_02129976.1
SequenceMDPSFEYIFPAIRGIQAGREFYVSMCPLRLLPKIFTFDDEELIPELRAQRVLNKARIPEMARYIISNMND
YVFSAITASIDAKVRFEALGQSGEANRVGSLHIPMDARFIINDGQHRRAAIELALREKPDLADETIAVVF
FLDKGLNRCQQMFADLNRYAIRPSKSLGILYDYRDDMALLAKSVVLKSPVFKDVVEMEKSTLSPRARKLF
TLSSIYFATNELLESIDGSQEEKTNMAINYWVEVAKYIKEWNLVRARKMTSAEVRREFIHSHGIALQSIG
KVGNHLLRNNPANWKRTLKKIENIDWSRSNSQLWEGRCMIGGRVSKSSHNVTLTTNAIKAALSLPLSSSE
TRVEEAYKRGDYEK

HomologueDndB
OrganismEscherichia coli SE11
Locus tagECSE_4579
PID2118
GID1118
length361 aa
DEFINITIONhypothetical protein ECSE_4579
gi 209921770
other link ref: YP_002295854.1
SequenceMASVDADYCYSFPAIRGIQAGRPFYIATCPMRIIPKIFSFDENDVPPELRAQRTLNKSRIPEMVRYLLEN
PKDYVFSALTASIAVDVQFDEFPGTNNLGTLCVPMDAQILINDGQHRRKAIEDALDARPELGQDNIPVLF
FVDEGLKRSQQMFADLNKYAIRPSPSLASLYDHRDASSNLARYLAMSVEPFVGMTELEKSSISQRSNKLF
TLSSIKQATRALLGKDPKESDFEECTQIATRYWQAIYHVMPDWQLAAKKEVSPVQLRQDYVHAHGIGLQA
LGQLGYTLLTDYPEQWPDKIAALKAFNWRRNNPDLIKRAMQHGKLSKTSTAIQLTCNALKNALSIPLTPE
EQELEAQMVVL

HomologueDndB
OrganismEscherichia coli 55989
Locus tagEC55989_4841
PID2119
GID1119
length361 aa
DEFINITIONputative DNA thiolation protein; putative phage protein
gi 218698031
other link ref: YP_002405698.1
SequenceMASVDADYCYSFPAIRGIQAGRPFYIATCPMRIIPKIFSFDENDVPPELRAQRTLNKSRIPEMVRYLLEN
PKDYVFSALTASIAVDVQFDEFPGTNNLGTLCVPMDAQILINDGQHRRKAIEDALDARPELGQDNIPVLF
FVDEGLKRSQQMFADLNKYAIRPSPSLASLYDHRDASSNLARYLAMSVEPFVGMTELEKSNISQRSNKLF
TLSSIKQATRALLGKDPKKSDFEECTQIATRYWQAIYNVMPDWQLAAKKEVSPVQLRQDYVHAHGIGLQA
LGQLGYTLLTNYPEQWPDKIAALKVFNWRRNNPDLIKRAMQHGKLSKTSTAIQLTCNALKNALSIPLTPE
EQELEAQMVVS

HomologueDndB
OrganismClostridium asparagiforme DSM 15981
Locus tagCLOSTASPAR_00196
PID2123
GID1123
length356 aa
DEFINITIONhypothetical protein CLOSTASPAR_00196
gi 225386449
other link ref: ZP_03756213.1
SequenceMQANREYYIAMVPMKLLKRLFAEEYSDYLSPEYRAQRLLNEFRIPEMKNYIVKNRNNYVFSALAASIDGS
IQFRASKMSDAVGILQIDMDAVFLINDGQHRKAAIEAALQEDESLGEETISIVFYKDEGLERSQQMFADL
NKHAMKPSNSLSTLYDSRDQLAVATKNVVNEVEFFHRFTDKERDILGKNSSKLFTLSNIYRANMKLLRKK
NCSSEDEMFMVQYWQTVSDNILEWQEVLHKDISKKELREGYIVTLAIVLNSLGRLGSYFYEHLDVDMKEA
LARLRGIDWSRANNKNWKGRIIREDGKIMSNEQAVILTCNKIKELTGVPLSQEENNKEQMFKRSHHEFKT
RRRKDL

HomologueDndB
Organismgamma proteobacterium NOR5-3
Locus tagNOR53_2874
PID2128
GID1128
length364 aa
DEFINITIONDNA sulfur modification protein DndB
gi 219674929
other link gb: EED31296.1
SequenceMTAEFEYVFPAIRGVQAQREYYVSMCPLRLIPKLFTFDEEELPPDMRAQRKLNLTRIPAISRYLIENKDN
YVFSSITASVNGPVIFEPIGDQDAHNRVGSLRIDMNAQFIINDGQHRRGAIEAALKEEPSLGDETISVVF
FIDRGLERCQQMFVDLNKHAIKPSASLNTLYDQREDISKIAKAIALESTTFKGVVEMEKSTLARRSRKLV
TLSAIKTATACLLAGKELKNIDDATSFSIKYWDELGKHISEWQLVSQGRITAGEIREGYVNCHAIVLQVL
GIIGNKLCDLSWKESKERLKLLEQIDWSRSNAKVWEGRAMIGGRMSKSSNNITLTSNYIKSQIGLDLSPE
EQRVEDAYLRGENV

HomologueDndB
OrganismAcidobacterium capsulatum ATCC 51196
Locus tagACP_3186
PID2132
GID1132
length359 aa
DEFINITIONDNA sulfur modification protein DndB
gi 225874732
other link ref: YP_002756191.1
SequenceMDVAFEYRFPAIRGIQSNREYYISMCPLRLIPKLFIFDEAELRPELRAQRTLNRARIPEISDYIVKNRDS
YTFSAITASVDGGIQFEPMSQDVSMTRLGLLRVEMNAKFIINDGQHRRAAIENALKADPSLGDESIAVVF
FHDRGLARSQQMFADLNMHAARPSRSLGLLYEQRDDLALITKEAIPRTKIFRDMVEFERSTLAERSRKLF
TLSAIYGANKVLTENRPFENRTEVLQFLIDFWDTVGSHMKEWQLIQQGRQTSGELRRDFIHAHSIALHAL
GIVGRDLVQQFPKNWKGKLRKLRDIDWSRSNTKDWEGRAMLAGAIAKTNSSQLLMANHIQKKLGLELTRT
VKDMKGANK

HomologueDndB
OrganismTolumonas auensis DSM 9187
Locus tagTolaDRAFT_2706
PID2139
GID1139
length358 aa
DEFINITION DNA sulfur modification protein DndB
gi 223578872
other link ref: ZP_03620384.1
SequenceMHMNDSGYCYSFPAVRGIQAGRPFYIATCPLRIVPKIFSYNEDDVPPELRAQRTLNKTRIPDMVKYLLDN
PKDYVFSALTASVGTSISFEEIGEAPNLGILQIPMDAQILINDGQHRRKAIEEALRENPDLGQDNLPVLF
FVDEGLTRSQQMFADLNKYAVKPSTSLGTLYDHRDESSELARYLAMEIEPFIGFTEMEKSNVSPKSNKLF
TLSAIKQATKALLSKGPRDGFSEEEQRLSIEYWKAVTKYIPDWQMMLNKKVSPSQLRQEFIHAHGVGLQA
LGIVGKQLLSEHPNDWESRLKPLQSIDWRKANPDWVKRTMNHGRISKSTTSILLTSNALKLKLGLALTPD
EKTLEKQL