Summary Sequence Alignment 16S rRNA Context  

32 homologues found:

HomologueDndC
OrganismStreptomyces lividans 1326
Locus tagSLG78
PID2028
GID1028
length498 aa
DEFINITION conserved hypothetical protein
gi 145244343
other link gb: ABP49154.1
SequenceMSTPKAAAPFQDRPLAEIVEELTEEIRELYVADEVPWVVGYSGGKDSTAVLQLVWLALKDLPAEQRTKPV
HVISTDTLVENPVVAAWVGQSLDTMRTAAQEQQLPIESHKLTPEIKDTFWVSLIGKGYPAPRPKFRWCTE
RLKIKPSNAFIRRVVRRHGEAILVLGIRKAESQARARAMARHEKGRVRDRLSPNGNLPNSLVYSPIEAWS
TEEVWAFLMQYPNPWGHKNKDLLTMYQGASDDSECPLVVDDTTPSCGDSRFGCWTCTLVEQDKSMTAMIR
NDDEKQWMRPLLKLRNELDDVTKEAQTRDFRRMNGNVQLFGDRPIPGPYKQSAREDWLRKLLAAQAQVRK
KAPEHVRNIELISMAELQEIRRIWVFEKHEVEDSLPQIYEQATGEKFPGLPLDEQLVLGAEEIGLLKEAC
EDDPIHFSMTRELLAIERQYRTMTRRAGLFEALEKAIKKGYYEDADDALRFAKRLQEMRESDPTQTTADE
EITTDAPA

HomologueDndC
OrganismStreptomyces avermitilis MA-4680
Locus tagSAV_2931
PID2029
GID1029
length525 aa
DEFINITION hypothetical protein SAV_2931
gi 29829473
other link ref: NP_824107.1
SequenceMTTIPLNLGLTPVRRKPFGGRSLEEVVNELTEEIRELYTADQVPWVIGYSGGKDSTAVLQLVWMALKGLP
AEQRTKAVHVISTDTLVENPVVAAWVSASLGTMQDAAQAQGLPVEPHRLTPEIKDTFWVNLLGRGYPAPR
PKFRWCTERLKIKPSNAFIRSVVAAHGEAIMVLGIRKTESQARARAMEKHEKRRVRDRLSPNANLPNSLV
YSPVEDWTNDDVWEFLMQKPNPWGYTNQDLLTMYQGASSDGECPLVVDSTTPSCGSSRFGCWTCTLVDED
KSMSAMIQNDEEKEWMTPLLELRNKLDAPFDEWKEGEEIPAGRKVGDPKPDKPARDFRRMNGKVMLFKDD
AIHGPYLQSFREEWLKDLLDAQTWIRAHAPEHVQNIELITLEELHEIRRIWVFDKHEVEDSLPRIYQEAT
GESFPGGPLDEQLVMGSDEMDVLKQVCDGDDLHYNMVRELLAVERKYRTMARRSGLFQALEQAVQKGYYE
DHEDAVEFATRKQKWRDDIAENLTFDDENELDAPA

HomologueDndC
OrganismPseudomonas fluorescens PfO-1
Locus tagPfl_0739
PID2030
GID1030
length496 aa
DEFINITION hypothetical protein PflO1_0739
gi 77456966
other link ref: YP_346471.1
SequenceMTTPPEAIIAEIQTLYSSDSLPWIVGYSGGKDSTASLQLIWKAVAALPSEQRTKEIHVISTDTLVENPVI
AAWVQSSLARMKVEADRQGLPIRPHRLTPSIEHRFWVNLIGKGYPAPRNRFRWCTDRLKISASTKFIQEL
SEANSEAILVLGQRRGESQARDKVLDHYSGSTRDRLSRNSDPKLSRVWVYLPIETWTSDDVWMYVLTDEN
PWGIDNQDLFDIYKGATPDAECPVVVDKSTPSCGDSRFGCYVCTMVSQDKSMHAMIQNDDQKSWMKPILD
YRNTYLSIQDWDKRDFKRMNGRVKIMGKGETSELIHGPYLQSYRAKLLEELLRTQLTLRNAKIPGHDQIE
LISIEEIDAIRRIWVEEKGEIEDLVPKIYERVLQQSYPGQAMEQHPLEPEDLALLNDVANEVDSEAGGRL
YQLARNLLAVQYQSMQSQKRSHHLDRLEEVLKANAFRTENEALEFARSNLEDGQEEINGGEELELIPLTA
VEAEED

HomologueDndC
OrganismPseudoalteromonas haloplanktis TAC125
Locus tagPSHAb0097
PID2031
GID1031
length555 aa
DEFINITION hypothetical protein PSHAb0097
gi 77362018
other link ref: YP_341592.1
SequenceMATDSVVQFHSAFNQDGLKNTIEQSIKHIKMLYQSDSIPWVIGYSGGKDSTAILQLIWYALQELAQEGKC
EKKVHVISTDTLVENPIVAMWVGKSLERMKEQADAQGLPIVPHRLTPAVKDRFWVNLIGKGYPAPRYKFR
WCTDRLKISPSNTFIQNMADKNGEAILVLGTRKAESTARAASMERFESSTTNTRKALGLTENGSLERVWV
YTPIASWSNDDVWVYLNSVDNPWNFPNHDLMGMYQGATEGGECPLVVDKSTQSCGDSRFGCYVCTMVSED
KSMNAMIANDDEKEWMYPLVALRNEIEVNDSNRAKKIEKLTRDKANRDFRRMNGNLTVHISKHGADLVPG
PYIQKFREHLLGKVLEAQLAVQQLGPDEVKNLELLPLEDLEEIRRIWLEEKHEAEDSVPKIYQNVFKKPY
PGKQRAHHPILNLDVLNKLKAHCQEQGDEDGLLYQQMRAVMSIANKHKNQLRRAKLSDELTQSLDKGAFN
NLFEAKQFALERERNRLQIQLSNSPNLTEDDKAAIQEKIIMVTKSIKEQGYSSLLIDFEEVQDDN

HomologueDndC
OrganismEscherichia coli B7A
Locus tagEcolB7_01003585
PID2032
GID1032
length540 aa
DEFINITION COG0175: 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes
gi 75228089
other link ref: ZP_00714764.1
SequenceMSKLVQAYDLAEYEDFINQEQFAGRPLAEYVAEVQRIYCADKRPWVIGYSGGKDSSAVITLVYLALLGLP
PEMRSKDIFVVSSDTLVETPVVVDLIKKTMLQIEAGAKRNGLPITQHAVTPKTNETFWVNLLGKGYPAPT
RSFRWCTERMKINPVSDFIKDKVSQFDEVIVVLGSRSSESASRAQVIAKHKIDGSRLARHTTLANAFIYT
PIDTWDVEDVWKLLRGAFRYAPEDIDEWESPWGGNNRPLWTLYMDSSAQGECPLVIDDSTPSCGNSRFGC
WTCTVVTKDKAMESLIKNGEEWMSPLLKYRDLLAFTTDPVNKDTFRNYKRRTGKVSYQYAKESDEPGAER
KHVPGPYWLKYRQQWLKELLEIERDLNAQGHTITLITKPELHAIRQEWLKDPNEPDWYDTLPGIYREVYQ
QDLDWVVDDQSRFDASDADLLVQIAQGFDVVPEMVMKLIELEVSMEGLSRRQGIFDKLGTILKQDWGTLE
EIEQQQVTLQKRVERDIHQEELTKLETELQVLQRRIVDASESSLLIGEEK

HomologueDndC
OrganismHahella chejuensis KCTC 2396
Locus tagHCH_07043
PID2033
GID1033
length527 aa
DEFINITION hypothetical protein HCH_07043
gi 83649648
other link ref: YP_438083.1
SequenceMSQRKTLYPSMDKMLEASAFAGRPALDLILEIQSLYLENDKPWVIGFSGGKDSTTVLSLIYVALTGLPEA
KRHKHIYVISSDTLVETPMVVDMINDSIEAINRNAQDKKLPISAHVVYPAWNETFWVNLLGKGYPAPTQN
FRWCTERMKIDPVSTFIKDKIARFGEVIVVLGARSQESSSRAQVIAKHKIEGSSLSRHSSLPGAFTYMPI
EDWTFDEVWMYLLGAPAPWGGDHFELFELYKDSSAGECPLVIDTNTPSCGNSRFGCWTCTVVTKDRAIEG
LIDSGEVWLKKLKSFRNKLFKTTLPENKNEYRNFKRRTGRIQYARGAIDNDNIAEIKTIPGPYLLEYRKQ
WLKELLTIEKNLIEEGRKIQLIHPEELHAIRKEWMFDPNEPDWSDELPKIYHSVYGEDLDWVEHDSGAFS
QADADLIAELSAENGVPAELVMKLLELELSMDGLSRRKGLFNKIENLLKNDWGSKEDIQAAKAAATHTSD
FKNKLKTELNTESSDLHLKSVYDEQLKALTKEYEALS

HomologueDndC
OrganismOceanobacter sp. RED65
Locus tagRED65_14682
PID2034
GID1034
length512 aa
DEFINITION hypothetical protein RED65_14682
gi 94499776
other link ref: ZP_01306312.1
SequenceMSRSTLYATMDEMISATEIAGRPLSDLIIEIQDLYLDDDKPWVIGFSGGKDSTTILSLIYIAIEKLELKQ
RHKHIYVISSDTLVETPMVVDMIEDVVNAINEKAKTNKLPMSAHQVHPKMDQTFWTNLLGKGYPAPTQNF
RWCTERMKIDPVSEFILDKVTRFGEVVVVLGARSDESASRAQVIAKHKIDGSSLSRHSSLPGAFTYMPIE
DWSFDDVWMYLLGAPAPWGGDHFELFDLYKDSSAGECPLVIDTKTPSCGNSRFGCWTCTVVTKDRAMEGL
IDSGETWLQELKDFRDQLFHSTLPENKDKYRNYKRRTGKVQYARKNLDSEATEVKTIPGPYWMERRQIWL
KELLTIEKKLRDSGKDITLIHPDELYAIRREWMYDPNEPDWADTAPKIYREVYGKDLDWADQDAGSFSQS
DAEILSSLGAEFDVPSELVMKLLDLEQAMDGLSRRKGLYKKIDSLLKQDWGSYEDIREKMVNHKHQHSLD
KNIDKGYDERLGELAAELESLN

HomologueDndC
OrganismBacillus cereus E33L
Locus tagBCZK0833
PID2035
GID1035
length522 aa
DEFINITION hypothetical protein BCZK0833
gi 52144391
other link ref: YP_082437.1
SequenceMLNNLITDLINNKNDFVSEAKEHIKKVYRADDRPWVVGYSGGKDSTVVVQLVFEALSELPTEQLHKKVYV
ISSDTLVETPLIIQSINVTLHRIQEEALKRDLPIETHKVKPKYEQSFWANIIGKGYPSPNQQFRWCTDRL
KIEPANAFVMDKVSTFGEVIMVLGVRENESATRDNVLKSHTVEGKDLMRHSTLTNAYVFAPIRQFSLNNV
WDYLLENPSPWGNDNHELNKLYQDSSSGECPLVVDKTIKESAGSCGNSRFGCWVCTVVNEDKALNGFILS
GSDWMKPLLEFRNWLAGIRDDRTFRMKYRKGGQIYFNPLKTEVKDDIEYVIIPKKSSRPKQMIKLEEFTI
LERDELKSYLAINNIDLSSPEDPKILVKLDNNQIGQLGLGPFTLNARKEILRRLLIVQRDLQHPEEEDFE
LIKEEELRVIRRYWLENGDWEDSLPSIFKEVMGYDLNWEYDDRPLFDNEQITDLESLCSKHNVDFKALKK
LISLEKDFSGYKVRRGLMNEIEKVLKQDYLHL

HomologueDndC
OrganismGeobacter uraniireducens Rf4
Locus tagGura_2474
PID2036
GID1036
length551 aa
DEFINITIONhypothetical protein
gi 148264519
other link ref: YP_001231225.1
SequenceMKTAKKKAGVPATNDSVQPECTVTETSLPNTDNSNSPAAKVRKSAFNELGFQATIELLQEEIRSLYIADE
IPWIIGYSGGKDSTATLQLVWTAIAELPAEQRRKTVYAISTDTMVENPVVAAWVANSLAVMKRASAEQLV
PIQPRRLTPALVDSFWVNLIGKGYPAPRHKFRWCTARLKISPSNSFINSIVSSSVEAILVLGTRKAESSA
RAANMARHEKGRVRDRLSPNSSLPGSLVYSPIEAWTNDDVWFYLMQVKNPWGYNNRDLLGMYAGASADGE
CPLVVDDSTPSCGDSRFGCWVCTLVDKDKSMTAMIQNDEEKEWMMPLLDIRDALDFRRDHKGEYAENADY
DIRDFRRMSGAVQVMSGGRPIPGPYIQSAREEWLRKLLIAQTYIRKNGPPEVQGIELITLEELQEIRRIW
VVDKHELEDSLPRIYREATGNDYPGRPLDDNLVIGEEEMHVLAELCGEDRLHYELTRELLSITRQQRTTS
RRAGLHEQLEKTFSRHFYDDKQDALTRAQQMADQKQRLSNNRQQFVSVVMEPLACDQEGEA

HomologueDndC
OrganismCandidatus Pelagibacter ubique HTCC1002
Locus tagPU1002_00505
PID2037
GID1037
length494 aa
DEFINITION hypothetical protein PU1002_00505
gi 91763093
other link ref: ZP_01265057.1
SequenceMENKKKSFFDEVGFKPTITKLVDLIAKLYLEDENPWVVGYSGGKDSSACLQLMWRVLEKIKSENKVIKPL
YVITTDTLVENPIVATWVKSSLDLLRDKAKDNGLPIFPSLLTPNIEETFWVNLIGKGYPAPNTKFRWCTE
RMKIRPSDRFLRKLSNESGEAVIVLGTRKAESSNRAQSISRFEKEATRQNFQPHVNLSNVSSFLPIKDWT
NDDVWLYLLQDQSPWGINNKDLLTMYQGATDGGECPLVVDTSTPSCGDSRFGCWVCTLVKQDKSMSAMVQ
NDSEKSWMEPLLQLRNDLTEKDFEKRDFRRLTGHVQLMPNDDERTVPGPYTKSTRKNWLERLLQAQNKIR
QNKKLPEELKKIKLITQEELDQIRKIWFYEKLETDDVLPSICEKEAKGEYHFEALEDSHVFNHEILQLLK
DTCGDDEMIFEIARGLLEVERKHFKSNRRTGLFDEFENIFKKSFYKDKTDAIEYAKEKRKIKSQGEKQLP
LINN

HomologueDndC
OrganismRoseobacter denitrificans OCh 114
Locus tagRD1_0799
PID2038
GID1038
length487 aa
DEFINITION hypothetical protein RD1_0799
gi 110678156
other link ref: YP_681163.1
SequenceMTSKNETDQTKRAGLDLVALQENIRAVYAADDRPWVIGYSGGKDSTCALQLIWSAIRALPEDARRKPIFV
LSSDTLVETPVIVNYIDDTLAAINAAAADQNMPITAQKVVPEISDSFWVNLIGRGYPAPSKRFRWCTERL
KIDPANAFIKNRVAEYGEVVMVLGVRSSESATRAQVMSLHKIDGTALSRHSTLPGAFVFTPIETFSVDDV
WAFLLQNQSPWGSDNRDLLAMYRNAQAGECPLVVDKQTESCGNSRFGCWVCTVVTKDKAMEALVENGEEW
LEPLLDLRDELAETQNPERKREFRDFRRRDGSVTFVGDAETSIPGPYLFEYRKELLRKLLEAQERVNANA
PPGEKTDLIQVEELREIRRIWRSEQGDWGDAVSETLKAVTGKELPADATDGFEFQADDAKVLADVCAAHD
LPSRLLAQLLEAERSVRGLKRRTLIHRKIASILEQEWRDEGTVLNERKARLKERKASSSDPLFETES

HomologueDndC
OrganismMesorhizobium sp. BNC1 plasmid3
Locus tagMeso_4572
PID2039
GID1039
length495 aa
DEFINITION hypothetical protein Meso_4572
gi 110347358
other link ref: YP_666174.1
SequenceMVRPSPLDGAIVESRLREIREVYLSDNRPWVIGYSGGKDSTCALQLVWTALLGLPAEHRTKPVYVITSDT
LVETPVIVRYIDVTLARIAAAAAEQGLPIKTEKVTPNVDRSFWVNLIGRGYPAPSRRFRWCTERLKIEPA
NDFIKARVAEFGEVVMVLGVRSSESATRAQVMSFHRIKGSVLSRHSSLQNAFVYGPIEAFSTDDVWTYLL
QSPSPWGNNNRDLVAMYRNAQAGECPLVVDTTTPSCGNSRFGCWVCTVVERDRSMEAMIDSGEDWLEPLL
EFRDLLAETQTPEKKRLYREFRRRNGHVSFIRGTDTPVPGPYTLTYCKTLLERLLETQVRVQREAPPGDD
TLLIHDAELHEIRRIWRAERGDWADSVPTIVRAAIGRELDWVMEDSVRFTAEDGRLLEEVCSERSVPTEL
IIRLLDVERAAHGLKRRHAIHTRIEELFRQEWRDLETVLQERLGSRSADIVEVDDLEEADALELPLGDAQ
AESAP

HomologueDndC
OrganismVibrio cholerae MZO-2
Locus tagA5A_0793
PID2040
GID1040
length543 aa
DEFINITION putative sulfurtransferase DndC
gi 153824553
other link ref: ZP_01977220.1
SequenceMIHELKLAEDLAEYEDFINHEDFANNKLSHYIADVQRVYCADKRPWVIGYSGGKDSSAVMSLVYMALLGL
EPKDRSKPVFVVSSDTLVETPVVVNHIKDSLNAIEKGAKRDLLPITCHKVVPENNQTFWANLLGKGYPAP
TRSFRWCTERMKIDPVSDFIKSKVSQYDEVIVVLGSRSQESASRAQVIAKHKIDGSRLARHTTLSNAFIY
TPIDTWGVDDVWKILRLCHLETKETPYGTKNIWIDKYDLEWENPWGGKNLVLWNLYKDSSGQGECPMVID
ETTPSCGNSRFGCWTCTVVTKDRAMESLIQNGEEWMSPLLEFRNKLSMTTEPANKEEFRNYKRRTGKVSY
QYAKEGEDIASERKHVPGPYWMKYRQQWLKELLELDKKFKSEGREIELITAPELHAIRQEWIHDPNEPDW
DDSLPMIFREVYGYDLDWVYDDNASFGKGDAQLISELCQDFDVEPEMIMKLIELEVSTEGLSRRNGISNK
IASLLKQDWGSLEEIKQKHASLQSKAEFDVHQQEIERYNQQLADLDKQLQKEF

HomologueDndC
OrganismVibrio cholerae MZO-3
Locus tagA51_B0786
PID2041
GID1041
length543 aa
DEFINITION 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase
gi 153800603
other link ref: ZP_01955189.1
SequenceMIHELKLAEDLAEYEDFINHEDFANNKLSHYIADVQRVYCADKRPWVIGYSGGKDSSAVMSLVYMALLGL
EPKDRSKPVFVVSSDTLVETPVVVNHIKDSLNAIEKGAKRDLLPITCHKVVPENNQTFWANLLGKGYPAP
TRSFRWCTERMKIDPVSDFIKSKVSQYDEVIVVLGSRSQESASRAQVIAKHKIDGSRLARHTTLSNAFIY
TPIDTWGVDDVWKILRLCHLETKETPYGTKNIWIDKYDLEWENPWGGKNLVLWNLYKDSSGQGECPMVID
ETTPSCGNSRFGCWTCTVVTKDRAMESLIQNGEEWMSPLLEFRNKLSMTTEPANKEEFRNYKRRTGKVSY
QYAKEGEDIASERKHVPGPYWMKYRQQWLKELLELDKKFKSEGREIELITAPELHAIRQEWIHDPNEPDW
DDSLPMIFREVYGYDLDWVYDDNASFGKGDAQLISELCQDFDVEPEMIMKLIELEVSTEGLSRRNGISNK
IASLLKQDWGSLEEIKQKHASLQSKAEFDVHQQEIERYNQQLADLDKQLQKEF

HomologueDndC
OrganismEnterobacter sp. 638
Locus tagEnt638_0471
PID2042
GID1042
length544 aa
DEFINITION hypothetical protein Ent638_0471
gi 146310136
other link ref: YP_001175210.1
SequenceMSKLVQAFDLAEYEEFINQELFAGRPLSEYIAEVQRIYCADKRPWVIGYSGGKDSSAVITLVYLALLGLP
PEMRNKDVFLVSSDTLVETPVVVDLIKKTMLQIEAGAKRNGLPITQHAVMPKTNETFWVNLLGKGYPAPT
RSFRWCTERMKINPVSDFIKDKVSQFDEVIVVLGSRSSESASRAQVIAKHKIDGSRLARHTTLANAFIYT
PIDTWDVEDVWKLLRGAFRYAPDDIDEWESPWGGNNRPLWTLYMDSSAQGECPLVIDESTPSCGNSRFGC
WTCTVVTKDKAMESLIKNGEEWMSPLLKYRDLLAFTTDPVNKDTFRNYKRRTGKVSYQYAKDGEEVSAER
KHVPGPYWLKYRQQWLKDLLEIERDMNAQGHTITLITQPELHAIRQEWLKDPNEPDWYDTLPGIFRNVYG
KDLDWVIDDQSRFNASDAELLEQIAQGFEVVPEMVMKLIELEVSMEGLSRRQGIFDKLGTILKQDWGSLE
DIKQQQETLQKRNDRDIHQEEVAKLEAELQMLQRRIAEVSEPTLLTSEEKERVN

HomologueDndC
OrganismShewanella pealeana ATCC 700345
Locus tagSpea_2306
PID2043
GID1043
length588 aa
DEFINITIONphosphoadenosine phosphosulfate reductas
gi 157962127
other link ref: YP_001502161.1
SequenceMADLFQADALDDEQLEYIQNEFFAGFKRYKNSDTLPAGLDKYDKLDDSLKHQVSINLCRELLREQKNNEG
FPLKHFIDDVQSVYCSDNRPWVIGYSGGKDSSAVVTLIYLALLSLDESKRTKPVYVVASDTLVETPLVVD
HVNRSLESIGNNAKKDGLPLTTHKVLPKPHQTFWSCLLGKGYPAPTQSFRWCTERMKIDPVSDFIKDKVS
QHDEVIVILGSRSQESASRAQVIAKHKIENTRLARHTTLANAFIYTPIDTWSMDDVWKLIRACSLEVTIS
PMGIGKKWADEYGLEWENPWGGKNLTLWNLYKDSSDQGECPMVIDDSTPSCGNSRFGCWTCTVVTKDRAM
ESLIQNGEEWMQPLLTFRNKLAETNVPANKDIYRNYKRRQGKVNYQRVKDGQELSEERAHVPGPYWLKYR
KEWLTELLVQQREFNKDGYSVTLVTEPELHAIRQEWLNDPNEPDWADSLPKIYREVFGVDLNWVINDNSS
FGEVEAQILTDLGEQYNVEPEMVQKLLDLELSLEGLSRRTGVFDKLGTLLRQDWGTLDEIKQRHAQLQSK
SDFDIHKDQIDKYEREILELEKQAKVEF

HomologueDndC
OrganismCandidatus Methanoregula boonei 6A8
Locus tagMboo_0359
PID2044
GID1044
length487 aa
DEFINITION phosphoadenosine phosphosulfate reductase
gi 154149904
other link ref: YP_001403522.1
SequenceMTSKKTPNGTTDSVFDKKGLQNIYREIREVYLSDSRPWVIGYSGGKDSTTALQLVWYAIAELPEEKRTKP
VFVISSDTLVETPVIVDYLTTTLERINKTAAEKKMPFKAFKLTPRIIDSFWVNLIGKGYPAPSTQFRWCT
ERLKIRTADRFILESVTKYGEVVMILGVRKGESATRDQVMNLYKIEGSKLSHHSRFPQSYVYTPIEEFSV
DDVWTYLLQKPSPWGNNNRDLLALYKSAQDGECPLVVDTETASCGNSRFGCWVCTVVQKDRSMEALIESG
EDWMEPLLDFRNELAETQIPEKKLEYRDYRRMNGKVKFMQAGDSKKVIPGPYTLEYSKILLRKLLEAQKS
VRKNGPNPNFSLILLEELQEIRRIWMTQKSDWNDSVVKIYEEVTGERLDWTKDDLGSFSQSEQDLLKKIC
DDQKLPLRLVTKLLDVERQMQGMTRRSSIYNRIGEVLSEDWISEDEVKKALINPKAVDTKRRSLRYV

HomologueDndC
OrganismBurkholderia ambifaria MC40-6
Locus tagBamMC406_0011
PID2045
GID1045
length484 aa
DEFINITION sulfurtransferase DndC
gi 172059077
other link ref: YP_001806729.1
SequenceMSMSPEQIVDELRELYLSDAIPWIVGYSGGKDSTASLQLLWTAIASLPKARRTKPIHVISTDTLVENPII
AGWVEVSLQQINLAAIQQELPITAHRLTPSLENRFWVNLIGKGYPAPRPKFRWCTDRLKISASTKFIQEL
SENHGEAILILGQRRGESQARDKVMDQYKTSTRARLSKNKDPRLSRVWVYPPIESWTSDDVWEYLITHPN
PWGISNQELFSIYRGATPDAECPVVVDTSSPSCGDSRFGCYVCTMVTQDKSMQAMIQNDEQKQWMQPILD
FRNNNLAGEDRAVRDFRRMNGRLTVFRDGLVHGPYTQAHRAKLLRELLLTQRVVRDADKEHGTQLIELIS
MDELEEIRRLWVEEKGEIEDLLPTIYAEVFGTPYLGRNLEQSPLDASDLKLLELAADEVDPEASQELYKL
TRSLLAVQFRTMESHKRSKHLDRLEEVLRHYAFRNENEAFEFAISNMSATTQDGDDLDATAVIA

HomologueDndC
OrganismSalmonella enterica serovar Saintpaul SARA23
Locus tagSentent_010100006025
PID2075
GID1075
length544 aa
DEFINITIONhypothetical protein
gi 167542817
other link ref: ZP_02338393.1
SequenceMSELVQAYDLAEYEDFINQEQFAGRPLAEYVAEVQRIYCADKRPWVIGYSGGKDSSAVITLVYLALLGLP
PEMRSKDVFVVSSDTLVETPVVVDLIKKTMLQIEAGAKRNGLPITQHAVTPKTNETFWVNLLGKGYPAPT
RSFRWCTERMKINPVSDFIKDKVSQFDEVIVVLGSRSSESASRAQVIAKHKIDGSRLARHTTLANAFIYT
PIDTWDVEDVWKLLRGAFRYAPEDIDEWESPWGGNNRPLWTLYMDSSAQGECPLVIDESTPSCGNSRFGC
WTCTVVTKDKAMESLIKNGEEWMSPLLKYRDLLAFTTDPANKDTYRNYKRRTGKVSYQYAKDGEDRSAER
KHVPGPYWLKYRQQWLKDLLEIERDLNAQGHTITLITQPELHAIRQEWLKDPNEPDWHDTLPEIYREVYQ
QDLNWVVDDQSRFDASDADLLAQITQGFDVVPEMVMKLIELETSMEGLSRRQGIFDKLGTILKQDWGSLE
EIQQQQATLQKRNARDIHQDEVEKLEAELQTLQRRIIDAGESSVLIDEENERAH

HomologueDndC
OrganismVibrio fischeri MJ11
Locus tagVFMJ11_A0170
PID2087
GID1087
length544 aa
DEFINITIONputative sulfurtransferase DndC
gi 197336779
other link ref: YP_002157727.1
SequenceMIHDLQLTEDLAEEYQEFINTEDFANHKLSHYVADVQRVYCADNRPWVIGYSGGKDSSAIMSLVYLALLG
LKEEDRTKQVFVVTSDTLVETPVVVNHINDSLAAIQTGAKRDGLPITCHKVVPEDDQTFWSSLLGKGYPA
PTRSFRWCTERMKINPVSDFIKSKVSQFDEVIVVLGSRSQESASRAQVIAKHKIDGSRLARHTTLANAFI
FTPIDTWGVDDVWKILRLCHLVTKETPYGTKNIWSNDYDLEWENPWGGKNLTLWNLYKDSSGQGECPMVI
DETTPSCGNSRFGCWTCTVVTRDRAMESLIQNGEEWMAPLLEFRNKLAMTTDPANKEEYRNHKRRTGKVS
YQYAKEGEDIASERKHVPGPYWLKYRRQWLRELLELDKKFKAEGREIELITVPELHAIRQEWIKDPNEPD
WDDSLPTLFKDVYGYDLDWVYDDNASFGKDDAQLIHELCDNFDVEPEMIMKLIELEVSMEGLSRRSGISN
KIASLLKRDWGSLEDIKQKHASLQSKAEFDIHQKEIERYNEQLADLDKQLQKEF

HomologueDndC
OrganismClostridium botulinum E3 str. Alaska E43
Locus tagCLH_1924
PID2091
GID1091
length542 aa
DEFINITIONputative sulfurtransferase DndC
gi 188590327
other link ref: YP_001921305.1
SequenceMNTELQQKIHNIIDEMKMVYKNDNRPWVIGYSGGKDSTAVVQLVFNMLQSLPTEERHKDVYVVSSDTLIE
NPIVLGYLKHNSILINEGAKKANIPLYTYMVHPDYNNTYWTNIIGKGLPTPTSIRFRWCTERLKIKPSNK
FIEEKVKESGEVVVVLGVRKSESIARGIRIRNREIEGYLLTPHVTLENTYVYNPIVELTTDDVWGLLLSD
NGSTPWGTSNNDLFTLYTGGEGGECPFTTTSDKDTPSCGNSRFGCWICTVVNKDKSLNGFIKSGETWLQP
LLDFREWIISIRNRHEYRMQYRRDGNHYYKKLYLDKLPLLNDYIINSDYIFANQDGEGYIDFKNCQSEIY
KGNTFISTDKDKVYLELLPLLSVTNSNDIKLDKSKIQKDDKGDFVNVLGYGPFNFEGRQLILKKLLEVQK
HINEEFEIELITKEELEIIDSIWDEEEDLTRRTLVDLYYEVMDERLPWDTYKKPMFDEATRSEIEKLCTT
HNLDKDLINKLLIETNKYKHFTNKTVLDKSITKILNQRHLHKSIIEEIENDN

HomologueDndC
OrganismCitrobacter koseri ATCC BAA-895
Locus tagCKO_03497
PID2095
GID1095
length544 aa
DEFINITIONhypothetical protein
gi 157147694
other link ref: YP_001455013.1
SequenceMSHLLQAYDLDSYEDFINQETFAGRPLHEFVSEIQRIYLADKRPWVIGYSGGKDSSAVTTLIYLALLGLS
PEQRNKPVFVVCSDTLVETPVVVNLISRTLKLIERGARQDGLPILVQQVVPKTHETFWANLLGKGYPAPT
RQFRWCTERMKINPVSDFIRDKVSQFEEVIVVLGSRSAESASRAQVIAKHKIDGTRLARHTTLANAFIYT
PIDTWGVDDVWKLLRGAFRYSSDVTEWETPWGGGNNLPLWTLYMDSSGQGECPMVIDDSTPSCGNSRFGC
WTCTVVTKDRAMESLVQNGEQWMAPLLEFRNMLAKTTEPEEKDKYRNFKRRTGKVSYQYLKEGEDISVER
KHVPGPYLLKYRQEWLEKLLNLDKVLKAQGHDIQLITEGELHAIRQEWLNDPNEPDWNDSLPKIYKRVYG
HDLAWQIDERVRFAGADAGLLHELATEHGIVPEMVMKLIDLEISFEGMGRRQNVQKKVESILQQDWGTFE
EIKEKYSSVQKKNQFDMLLKEKEDIELALDDLSNDFDRLENILNSVTSNDEVAK

HomologueDndC
OrganismMycobacterium abscessus ATCC 19977
Locus tagMAB_1095
PID2100
GID1100
length512 aa
DEFINITIONhypothetical protein
gi 169628189
other link ref: YP_001701838.1
SequenceMKRSLPITPKRRSAFDELGFSATVEAVVRQAQELYAADNVPWVVGYSGGKDSTAVLQIVWMALQGLPKKQ
RHKPVHVISTDTLVENPVVASWVTHSLEVMEAAAVKSELPLTPHRLTPAVADTFWVNLIGRGYPAPRPKF
RWCTERLKIKPSNTFIRDMVTTHGEAILVLGTRKAESSGRSHRMTELEARRVRDLLSPNNSLPNCLVYSP
VEDWSNDDVWTFLMQEANPWGYSNKELLTMYQGASPDGECPLVVDSSTPSCGDSRFGCWTCTLVDKDKSM
SAMIQNDEEKEWMLPLLDLRNALDVADDRHLRDFRRMNGSVQLFHGKPIPGPYTQDSREDWLRRLLDAQA
FIRAEGPDYVRSLDLITQAELDEIRRIWVVEKHEFEDHLPAIYERAMGVPYPGRPLDEHLPLGPELIDTL
REVTGGDRLHFELVRELLDVEQRYRTQSRRAGLFDSLEAAIRRNFYDDQDDALSRAQRRKAAMDRSGGQT
DGPDPLDIADGYVRHAESELVQ

HomologueDndC
OrganismClostridium perfringens NCTC 8239
Locus tagAC7_1517
PID2104
GID1104
length541 aa
DEFINITIONputative sulfurtransferase DndC
gi 168217096
other link ref: ZP_02642721.1
SequenceMSSLNINDKINNILDEMTRVYKNDSRPWVIGYSGGKDSTTVVLLAFKMLQNLPKEERHKPVYVISSDTLI
ENPIVLSYLQQNSKYINEGAKNLGLPLYTDMIHPDYNNTFWANVIGKGLPTPTSIRFRWCTERLKIKPSN
KFIEDKVKENGEVVVLLGVRKSESIARGIRIKNREIEGYLLTPHVTLQNTYVYNPIVELSTDDVWAILLS
NNGETPWGTNNNDLFALYMGGEGGECPFTVTNDSETPSCGNSRFGCWICTVVKEDKSLTGFIESGETELQ
PLLDFRSWLLSIRDKHEYRQKYRRDGNHYYKKLYLEKMPLLNDYIIDKNHLFFDKENNEGYIDLVRSKET
DELLNKKSTDKDKIFLELIPTVESGEDIKLDLSKIHSDSKGEFINVVGYGPFNFKARKLILEKLLETQNK
IQESYDLDLITIQELEAIDKIWDDEEDLTRRSLVEIYYNKTGNRLPWDDYKKPIFDNSTLETISNLCVET
DIPEDLINKLLIESNKYKHFTNKTILDKSISKLLNQKHLHKSLVEEIDNDN

HomologueDndC
OrganismExiguobacterium sp. AT1b
Locus tagEAT1bDRAFT_1707
PID2108
GID1108
length551 aa
DEFINITIONsulfurtransferase DndC
gi 187605118
other link ref: ZP_02991320.1
SequenceMTQGIISNLFTQHEGDTVSRRSIDLIKRVYLNDTRPWVVGFSGGKDSTLTTQLIFEALLELSPEQLHKKV
FIISSDTLVENPLVVSMINGSLHRMQEAAFKYNLPIETQKVKPLTEKTFWTNIIGRGYPTPNQTFRWCTD
RLKIDPANRFIKDKVSKYGEIIMVLGVRSSESTSRGQSIKDHEISGSELMRHTSLANAYVFAPIKEFVLD
DVWSYLLQNPAPWGEDHHKLQKMYMDSSSECPLVVDQNIKESAGSCGNSRFGCWTCTVVNQDKSLTGFIQ
TGEHDWLKPLLKFRNKMVLIRDDRSKRMHKRMNGAFYLLEVQHEIKEDGIYIVQKKKGGRAATSHKVVDR
IEDLTDESVLAVPKAQLSQFIAKHNIDLSKPEEFNIQFVVTETNEDGQSAYSHLGLGPFTLATRNELMRD
LLILQRDLKVPNSVEYKLIQDDELRAIRRLWLREGDWNDTLPELYREVFGVDLDWEHDDRQILTSDQAND
LELLSQKYGLDFNMVQKLFTTANDFLGVKVKRGFNKDVAALLSQDYLSLYKEQGVLERDED

HomologueDndC
OrganismDesulfatibacillum alkenivorans AK-01
Locus tagDalkDRAFT_5060
PID2112
GID1112
length508 aa
DEFINITIONphosphoadenosine phosphosulfate reductase
gi 163722439
other link ref: ZP_02129977.1
SequenceMKNDKEVVLGESFDDSAFEELGFNSIIGQINEEIQSIYLADEIPWVIGYSGGKDSTAILQLVWHAIGLLP
PQKRIKPIHVISTDTLVENPIVAQWVDSSLSKMRIAAKNQNLPIRPNKLRPRVEDTFWVHLIGRGYPSPR
PWFRWCTDRLKIWPSNNFINSLVKNYGEAILVLGSRKAESSRRAHVMKTLEKKRIREKLSPNTHLPNSYV
YTPIENWSNDDVWLYLDNIENPWLGTNKELFDLYKGATEQGECPFVTNSTSPSCGNSRFGCWVCTLVAED
KSMTAMIQNDEDKEWLMPLLKIRNEIAVKEDRHLRDYRRMNGAVQIFKGRTIAGPYKQSFREDLLRRLLE
AQLWVRENGPESVSDIELVSLEELREIRRIWLTDKHEIEDSLPRIYESVMNLPFKEGRSTNNSIFRDKEI
NLLRDLCNGDELHFSLIRELLDIEQGYRSTVRRAGLYEKIEKAFSKHIYRDEEDATDRALRQREAIKLAE
EGHYENKSKEDYDFNKDR

HomologueDndC
OrganismEscherichia coli SE11
Locus tagECSE_4578
PID2117
GID1117
length544 aa
DEFINITIONputative 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase
gi 209921769
other link ref: YP_002295853.1
SequenceMSKLVQAYDLAEYEDFINQEQFAGRPLAEYVAEVQRIYCADKRPWVIGYSGGKDSSAVITLVYLALLGLP
PEMRSKDVFVVSSDTLVETPVVVDLIKKTMLQIEAGAKRNGLPITQHAVTPKTNETFWVNLLGKGYPAPT
RSFRWCTERMKINPVSDFIKEKISQFDEVIVVLGSRSSESASRAQVIAKHKIDGSRLARHTTLANAFIYT
PIDTWDVEDVWKLLRGAFRYAPEDIDEWESPWGGNNRPLWTLYMDSSAQGECPLVIDESTPSCGNSRFGC
WTCTVVTKDKAMESLIKNGEEWMSPLLKYRDLLAFTTDPVNKDTYRNYKRRTGKVSYQYAKDGEDRSAER
KHVPGPYWLKYRQQWLKDLLEIERDLNAQGHTITLITEPELHAIRQEWLKDPNEPDWYDTLPGIYREVYQ
RDLDWVVDDQSRFDASDADLLVQIAQGFDVAPEMVMKLIELEVSMEGLSRRQGIFDKLGTILKQDWGSLE
EIQQQQATLQKRNDRDIHQEEVTKLEAELQVLQRRIVDASESSVLVEEENERAH

HomologueDndC
OrganismEscherichia coli 55989
Locus tagEC55989_4840
PID2120
GID1120
length544 aa
DEFINITIONputative DNA thiolation protein; putative phage protein
gi 218698030
other link ref: YP_002405697.1
SequenceMSKLVQAYDLAEYTDFINQEQFSGRPLAEYISEVQRIYCADKRPWVIGYSGGKDSSAVITLVYLALLGLP
PEMRNKDVFVVSSDTLVETPVVVDLIKKTMLQIEAGAKRNGLPITQHAVTPKTNETFWVNLLGKGYPAPT
RSFRWCTERMKINPVSDFIKEKVSQFDEVIVVLGSRSSESASRAQVIAKHKIDGSRLARHTTLANAFIYT
PIDTWDVEDVWKLLRGAFRYAPEYIDEWESPWGGNNRPLWTLYMDSSAQGECPLVIDESTPSCGNSRFGC
WTCTVVTKDKAMESLIKNGEEWMSPLLKYRDLLAFTTDPVNKDTYRNYKRRTGKVSYQYAKDGEDRSAER
KHVPGPYWLKYRQQWLKDLLEIERDLNAQGHRITLITESELHAIRQEWLKDPNEPDWYDTLPGIYREVYQ
RDLDWVVDDQSRFDASDADLLVQIAQGFDVVPEMVMKLIELEVSMEGLSRRQGIFDKLGTILKQDWGSLE
EIQQQQAALQKRNDRDIHQEEITRLEAELQVLQRRIVDASESSVLVGEENERAH

HomologueDndC
OrganismClostridium asparagiforme DSM 15981
Locus tagCLOSTASPAR_00197
PID2124
GID1124
length450 aa
DEFINITIONhypothetical protein CLOSTASPAR_00197
gi 225386450
other link ref: ZP_03756214.1
SequenceMEEMKLVYLHDKRPWMVGFSGGKDSTVLVSLIFEMLNSLDPKQRHKMVHIVSSDTMVENPIVRDYMHDVS
NMINIFGKSLRVDAKIIYPRVEDTFWCRVIGLGYPTPEPPGFRWCTERLKIHPMNRFTVNTIKKNGEIVL
LLGVRKAESSYRARNIKNREIDGKLLVPHSDIENAYVYNPLTEIPNDVVWKYLLKDDGKSPWGTSNKYLF
SLYQGENLGEEASVIGEVDKDKIPVTGNSRFGCWVCTMVKEDKSLKNFIEKGEKWLEPLRDFRNELLELR
SDPGAREDKRRNGAVYLVKGGTEKGKGPFTLDARYRILEKLLDLQVKIQEQKGREALELITVEELKMIDR
MWEAEGDLSRRKLVDLYHRKMGKRLPWDEFRVPLFDEETIACIKEYCQVYNVEFELISKLLISIEKNKNY
TRGNSVQREFDKILNQGWLHFERIQEGLKI

HomologueDndC
Organismgamma proteobacterium NOR5-3
Locus tagNOR53_2490
PID2129
GID1129
length521 aa
DEFINITIONputative sulfurtransferase DndC
gi 219674930
other link gb: EED31297.1
SequenceMSESPKKQRKTAFRELGIKQHVENLEEQTRQLYLSDEIPWVIGYSGGKDSTATLQLIWSALSKLSPKDHI
KPVHVISTDTLVENPVVALWVEKSLSKMRAASGEQSMPIKPHRLTPEVKDRFWVNLIGRGYPAPRPKFRW
CTERLKISPSNKFISETVQQNGEAILVLGTRKSESAARASNMKQYESKSTRDLLSSNKELDRVWVYTPIA
EWQNDDVWQYLTQFENPWGFPNEDLFGMYQGATEDGECPLVVDTSTPSCGDSRFGCHVCTMVNEDKSLSA
MIQNDVEKEWMLPLLEFRSNWININDADPEKKKQKIDEERKHRDFRRMNGSLTVFNGRLVHGPYKAYYRE
NMLRAVLEAQMAVREIGPDSVKDLEVISLEELEEIRRIWVVEKHEIEDRLPVVYEEATGQKYPARRNMSD
LGLSQEDLTLLKEICQEVDDSEIHYEVVRALLHIEHQNRTMVKRNKGFFKNLEKVLESGVFSNEADAQDY
AVSKQSKKDDIIASASDEFSQSDYIQLKEIS

HomologueDndC
OrganismAcidobacterium capsulatum ATCC 51196
Locus tagACP_3185
PID2133
GID1133
length512 aa
DEFINITIONputative sulfurtransferase DndC
gi 225874731
other link ref: YP_002756190.1
SequenceMKSPQVGRQSAFKAQGFRKTLELLAENVQALYLSDEIPWVVGYSGGKDSTATLQLIWTAIAALPAEKRTK
VIHVISTDTLVENPIIAGWVNASLLTMQRSASDQDLPFRPNRLLPELKDRFWVNMIGRGYPAPRPKFRWC
TERLKINPSNNFIRNVVDDAGEVILALGTRKAESQVRSASIDHYSKNARAGLQRHGQLDRSWVFSPIVDW
SNDDVWQYLMQVKNPWGIDNKDLLGMYQGATEDGECPLVVDTSTPSCGDSRFGCYVCTMVTEDKSMRSMI
ANDSDKAWMLPLLQFRNQYLGNLNDRNVREFKRLNGSLMVHNDRLVHGPYTQSYRVNMLRALLETQLTVN
KHLPKGIDSLELITIEELREIRRIWIEDKHEVEDLLPAVYEDTLKRPFSANSVSVVPLLRTSEIETLREI
SDGQTVESRLHYELLRELITTQAVSKSTHSRAKLLDELDRVLERSAFADADEALSVALSRRGMSASEDSG
LGGQDMPSLFVNITLPEQNDVS

HomologueDndC
OrganismTolumonas auensis DSM 9187
Locus tagTolaDRAFT_2705
PID2138
GID1138
length543 aa
DEFINITION sulfurtransferase DndC
gi 223578871
other link ref: ZP_03620383.1
SequenceMTDQLLLAEDLEGYEEFINQEYFAGLKLNHYIADVQRIYCADKRPWVIGYSGGKDSSAVMSLVYMALLGL
PKDQRQKPVFVVSSDTLVETPVVVNHIKNSLKAIESGARRDGLPITTHQVVPKSNDTFWVNLLGKGYPAP
TRSFRWCTERMKIDPVSDFIKTTVSKYDEVIVVLGSRSQESASRAQVIAKHKIDGSRLARHTTLANAFIF
TPIDTWSVDDVWKILRLCHLETQDSPYGVKNIWKDIYDLEWENPWGGKNLTLWNLYRDSSGQGECPMVID
ETTPSCGNSRFGCWTCTVVTKDRAMESLIENGEEWMNPLLEFRNKLAFTTDPENKDEFRNYKRRTGRVAY
QYAKEGENIATERKHVPGPYWLKYRKQWLKELLELDKQYKDERREIELITAPELHAIRQEWLRDPNEPDW
NDSLPSIFKEVYGFDLDWIYDDGASFGKDEAALLRELSSDFDAEPEMVMKLIELEISMEGLSRRSGISDK
IASLLKQDWGSLESIKDKHAALQSRAEYDVHQKEIDRYNQELAEIELALKKEF