Summary Sequence Alignment 16S rRNA Context  

32 homologues found:

HomologueDndD
OrganismStreptomyces lividans 1326
Locus tagSLG77
PID2046
GID1046
length628 aa
DEFINITION conserved hypothetical protein
gi 145244342
other link gb: ABP49153.1
SequenceMNGCGKTTLLDAIQLVLYGPRARCSGRGNRSYDTYLRESINRAADPQRGAELRLEFSITVEGRPRTYEVA
RTWFAKGKQVRESLAVTVDGKYDDTISETWAEHVEEILPLEVASLFFFDGEKVEQLADPERAADVIEAAV
QSLLGVRAVEQLRTDLLALQRRQRLSQEDQGILEQIRDLKVKSQAAAQEVSDQSQLLAQATSHLDVAQAQ
LAKIERDFERAGGRLYEERRGLEAAKEATAERLAQTQKDLRGLAEGPLPLLLLRGELAALQEQSVREQEA
AEARQVIGVLERRDAWLVDQLPDGVPAADRTALKRKLTADRKKRAAATELALDLSLPPDLPQKLAALDEV
LETDAARAAELLRSADKTVHELQQAERQLAAVPDEQQIKTLIEDRQQASEAVIVARAAVEQHRELVAEAR
SRHERLEADLERARQKMVRTFVREEELQRVVAYADKARTTLDRFGEALLRKHISSLEVAVLRSFQTLMRK
SGLIKDLRIDTNKFTLALTNRDEEPLDPARLSAGERQLLAISLLWGLAKVAGNRLPTVIDTPLGRLDSRH
REHLVDRYFPHAGRQVLLLSTDEEIDEHLLQRLRPSIAHSYVLVHDDTTFTTRVAEGYWWTEGALHAV

HomologueDndD
OrganismStreptomyces avermitilis MA-4680
Locus tagSAV_2930
PID2047
GID1047
length675 aa
DEFINITION hypothetical protein SAV_2930
gi 29829472
other link ref: NP_824106.1
SequenceMLLRKITLEEFGAYRGKQSLDLTPKKNKPIILIGGLNGCGKTTLLDAIQLVLYGNRARCSGRGTKAYETY
LRESINRKADPSRGSAITLEFTVMTGGHEHYYRLVRSWHISGKTLKEFLNVYVDETYGERVKAQRSAEPE
GKFNRLLSEGWADHVESLLPLEIASLAFFDGEKIESLANPERAASVIESAVHSLLGVSTVQQLRNDLLAL
QRRQKLSEEEQHLLDNIRAQEAEREAVVSQYDIAHQELAHSRSELGKAQRKLDSLEKAFADEGGDLFTRR
VELENDRKQALVRLAQVRTELTQLAAGPLPLLMVAPLLDDVRQQARIEQEAQQSAQVLEVLEERDRWLLE
LMPDATRAEVLKRLDDDRAERAAKTQLAVDLRLPHDALAQLTVLDELLQRDTQRSAQLLHSAAELAEHLD
QLDRQLAGVPAQDKVEALQAARGEQIVEVTRCETTRDRATAKLEDLKRRREHVTTLLERAHKEFVRTKVK
AEEVERVIKYSEKARDTLERFGSALLERHISRLEVAVLQSFKVLMRKQGLVRDLRIDTDKFILTLADADG
EAIDPARLSAGERQLLAVSLLWGLMRVAGNRLPSVIDTPLGRLDSRHREHLVDRYFPNASDQVLLLSTDE
EIDEYLLGRLEKSVAHTYTLVHDDTEFTTAVVEGYWWSAGASHAG

HomologueDndD
OrganismPseudomonas fluorescens PfO-1
Locus tagPfl_0740
PID2048
GID1048
length660 aa
DEFINITION hypothetical protein PflO1_0740
gi 77456967
other link ref: YP_346472.1
SequenceMAKLSINQISIENLGPFRERQNFDLSVMPGRPVILLKALNGSGKTTLLTALQIGLYGYKAINIARRTEYE
QLIAGLQRTDATGPARIEMHLSVEVGHYIQELTLRREWHPKEKGFGEQFRVFAGHMEDLALAEDWDEFIN
GILPVELVHLFFFDGEKIEALANPERLPALLRRATEVFLGLGGIDALAGDLKAVERRANKKVLPTDCAGN
HSQTSEYELELKQLEQRIEMLSQRQAHARTNLDEAQRKLESFSIEAQRSGLDAYQQAAQLRVRLALCEQE
YGRARALLVTALEDPILPLTWLGPLWESYKAYWQKDHQSKHNDLIVEEFAKRDQRILERLALDAPHVISI
AAELFAADLKGLRVDKSHIPILLSGGDPTEIEAQFQQAKRRLRDAKEIVATAQRTMEKAQDAVHQIPAHE
QLSTVFEAMQQHTRGVSAAELQLHELSRELEEARNKQAHFELRYQAASARARAELKENAFHLKALEAADR
AKVVLGLFRERLLASKAQWLSEMITTEFKQLLRKRNLISRVLVEAETYAVSIEDVNGYTLPMERLSAGER
QILAIAVLSALIRERKGRFPVIVDTPLARLDRSHREALVHNFFAKISHQVMVLSTDEEVEGTVHMALEQH
MSREYSLMFDDESRRSVVSINTQQFQLDTL

HomologueDndD
OrganismPseudoalteromonas haloplanktis TAC125
Locus tagPSHAb0096
PID2049
GID1049
length652 aa
DEFINITION putative ABC transporter ATP-binding protein
gi 77362017
other link ref: YP_341591.1
SequenceMIIKQLTLENFGIYQGRHEVNLSTSANKPIILFGGLNGGGKTTFLDALQLVLYGKHAKCSNRGHQSYGNY
LISTKNRYVGNDDTVEISLTFTHTTDTTTNEFVIVRSWKTNTKDVKDKVVVYCNQQEDSHLSQYWDEFVN
EFIPLSLSDLFFFDGEKIENLAHPDRSADLIKTGIENLLGLDLLSQLQIDLNNVERKRKSENLDTTVVAK
VEALEAEITEQTTIVTGFKTDIANLEKRASDTNLSINKARQKVRSAGAHLIEERDIIKFELGAIEEKLKA
NLAERVKLDAGCGPLGLIPNLISSTKAQIKKEEQAVQANVIQSAITEYEATITQTLVNENVPETALSALS
NKMATLAKEREELASTECYIASNIAIFNGLDEKIANDKLERSNLLKARVELFEQQALFNKKLESIPDYET
VQHLLSELAGLEVELKNSFVLIKQKQQLLQQAQARDEVLNTRYANLLTQQSKDTFEQKRSIQVADHIGKL
KNTMKSFADELIRENVTGLEEHIAAKFFDLSRKNNLITGVKICPDSFKLTLLDNNKNPMSPSRLSAGERQ
LLAIAILWGLAEASGKEIPTVIDTPLGRLDGKHRSKLINNYFPKASSQVILLSTDEEITGQYYTQLKPAI
CREYHISYNEHEQTSTFTEGYF

HomologueDndD
OrganismEscherichia coli B7A
Locus tagEcolB7_01003584
PID2050
GID1050
length666 aa
DEFINITION COG0419: ATPase involved in DNA repair
gi 75228088
other link ref: ZP_00714763.1
SequenceMLIKQLVLHNFRVFNGTHTIDLAPRKRPHDLNPRPIVLFGGLNGAGKTSILSAIRIALYGRLAFGLATQQ
QEYIEQLSALIHNGAYYIEQPEEASVELTFTYNKGGHEAEFTVTRTWKKGKRDRLSLQQDGQPLSELDYD
QCQGFLNELIPHGIADLFFFDGEKIAELAEDESGNILRTAVRRLLGLDLISKLRNDLMIFVKRQQSSQLA
SSQQQQIAELEKQSKELACQTEALLESADFAKSRIEFLSKDITHYEGLLNAQGGAFAQTKAQEKQKVETL
LKDKEHLEKALRQECDGSLPYALAPTILSHLLQQIADETQIKQAKSFEKELSQFLTQLRNDIAFRSAGTG
KIAAEAITDNLKDYMATKPKGDLLFDISEREAGMLQQSIEIDSKRAWQRFELYRTQLSEIEQQLEQAAAN
IARAPEDEQLMDLFEKLRDLDRQREAQLQKYRSLLEDAKRKKQQQLDCVRQIQKAHDAARYQHSYSSAFK
NAQETINLLDRYSDVLTQARVKTLSTNFELAYRKLARKEDLQLSAHINPQTFDVELIDENGSVINRKLLS
AGEKQIYAIAILEALAKTSGRDLPVIIDTPLGRLDSQHRDKLINHYFPEASHQVVLLSTDTEVDERYFVD
QLRDDISHAYEIVFNAHTKSSTLKPGYFWELTKEAI

HomologueDndD
OrganismHahella chejuensis KCTC 2396
Locus tagHCH_07044
PID2051
GID1051
length663 aa
DEFINITION ATPase involved in DNA repair
gi 83649649
other link ref: YP_438084.1
SequenceMILKSLYLQNFGVFQGSFDDNHVDLEPRVKYNRKRPIILFGGLNGAGKTTTLTAIRLALYGKQSLGRSVS
VQIYHQFLVDAIHKPKGKVLAPNTAGIKLDFNFGRQGEVIDYTVERVWTVRGKSVFENVEIYQNDEHLKS
LTDHQKQAFLNELIPIGVADLFFFDGEKIADLAEDNNNSALADAINRLLGLDIIDRLKADLGVYLRDRKR
DKLPSAIQKEMEALENSYKSLYSKYQSQLADIEALRIESTELETTKERLNQIINDLGGAWASNRQEAETK
EKMLRAKRNELQVQIRNLIADAAPLALATNQIAALLKQLTDEQQSKRQLVLQVELRKQLNKIQSALIKSL
GKEHKKAIETSIEESLPAATSIDTNIIHDISDSEFNRLNHLITKVVPEQQAKVKALSSELEEVEEELAHV
GLNISRAPDERRISNFVSELGEIENSLGQRQVEIKQRTEAAKATLREAMDSLRKLREKEKEFGNVTNLDQ
AVTLADRTRGLLESFSSKSRETRINTLEQEFIKSFAKLARKDDLMITAKIDPETFSVSLIDGTGHIIDKK
KLSAGEKQIYAIAMLEALGRTSGRNLPIIIDTPLGRLDSHHRENLVKNYFPTASHQVLILSTDTEVDEDF
YKELSPEISHAFEVAYDPEAGSSVYYEGYFWRH

HomologueDndD
OrganismOceanobacter sp. RED65
Locus tagRED65_14687
PID2052
GID1052
length656 aa
DEFINITION ATPase involved in DNA repair
gi 94499777
other link ref: ZP_01306313.1
SequenceMILNTLTLQDFGVFNGYHEINLEPKEKYNRKRPIILFGGLNGAGKTTTLTAVRLALYGKQSLGKSVSQAK
YEQYLADSIHKGKAQLVPATNASVGLSFTYGKHGVVNEYKVIRSWEIKGSTTSENLVVEKDGEPLSGSTN
EQLQSFLSELIPIGVADLFFFDGEKIAELAEDNANEALADAINRLLGLDIVERLRADLGIYLREHAQQKL
PKDISAEIKSLENQYQDSYKSYQDKLDLVSELKTKAGSVEADIEALNARLNDLGGAWAKTKEKEEHRVDR
LVEEKNRLKSELTALFSEAFPLSLAPNTLNNLIKKLDAEKQTKSNQASRAKIELKVQELKAQLGELDNAG
KVIDDTFSDVLDTSGDVDVIHDISDSDYMNIQQLAVHKLPEQLKRFKKLTKDLEEIESEISAAADNIARA
PDESRLKDILDELGIQQKELGKVDAEIQQEKDNAKARLRAAIDTMRKLKDLDAKYSTSMSSIQGVKLASD
SRELLLEFGRITKDRKIELLEQEFIKSFGKLARKDDMEILAKIDPKTFSVTLKDKHGKEINKKKLSAGEK
QIFAIAMLEALGRTSGRNLPVIIDTPLGRLDSHHRTKLVKNYFPTASHQVLILSTDTEIDESFYKDLSPE
ISHAFYVDYDPNEGSSKYTEGYFWRK

HomologueDndD
OrganismBacillus cereus E33L
Locus tagBCZK0832
PID2053
GID1053
length663 aa
DEFINITION possible ATPase involved in DNA repair
gi 52144393
other link ref: YP_082436.1
SequenceMLIEQLELENIGAYTERNTFDLSISSPKKKVILIGGENGAGKTTFLNSIKLGLFGCFGYGYKTENNDYYK
RVHGYLNASARKDETNPFSITITFSEVENYKRHVYTFKRSWNILNSAIKEKFTVKKDGHYLNDAEKDIFE
SRLRENFPPKLFDLCLFDGEEISKIINENKLSSYLKELSTVIFNLDLFRNLEGDLTNYLQQEIDQEHLSS
IESEILTLQRQEKEQSLKIEDLEDTIKTAQQQIEESKESYSLLKKDFETHGGLIKEERETLNRQVLEIEA
HRKANSEKVREFIQTLLPFYLNKNLLLSTKNQLQNEEKLSLANQLTSELTEERALELAKSLPGVSAPNDL
AAELRKQIFNIIKPNDTDVEYIHRVSPTQRTQFEVAAQQVERESHDTYMQLLQENRENLLQAQELRKKIS
TNDSTNEFAQMLETMTQTQEKIFKLEKEVEENLSILETRQETLEALKNTIDSKQNIVQQSNKTRNTFLIA
QSIMKLSTEFQMLQHQKKLQQVQIEATKMLNKLMRKHQYISSLRIDSSTFEVTLYDNNRDHVAKETLSAG
EKEILLLSLIWAMFKCSGRRVPFIFDTLLGRLDQTHKHNILVDFIPACGEQVLILSTNSEVDEKHYNLLK
NFVSHGYLLEFDTELRKVNVTDQYFNFNKEQAK

HomologueDndD
OrganismGeobacter uraniireducens Rf4
Locus tagGura_2475
PID2054
GID1054
length658 aa
DEFINITIONhypothetical protein
gi 148264520
other link ref: YP_001231226.1
SequenceMILDTIILENYGAYGGRQEALLTPEEGKPIILFGGMNGGGKTTLLDAIQLAFYGPKARISNRGKLGYKEY
LRESIHRGGDPGEGAGITVRFRRVIEGKSRNFELQRCWREGVKGIEETVRVLRDGLPDDIFTEHWDESIE
AYLPSSIAHLFFFDGEQIKELAEGGHAADILGTAIHSLLGLDLVDRLENDLKVFERRKKAEGLDPEATRK
LAIARSEFVEIFREEEKAASLSGALTNESNQLAKELHAKEELFRKEGGDLFLRRKELEDELVALKARKAA
TEAQFRELIAGPLPFLLVENLLAEVEQVVRHETEIKRARVLLEVLETRDTEVLDSLKAEKIGGQLLRSMD
RILEKDRKSRAGLAKKTLILDADDTLAPQIAHLRGTVLPTAEQQACDFTAKIAALDEKIARLEGELDRAP
TAERIAEVQEVLEAARKAHQAKLAELEAIKVRRQALQRQRLMAEARLDKMGENDVNSQFHEDGRLRMLKH
SLRVRETLGRFRTKIVKHHTENMESLMLESFCKLLRKKELVSGLKINPETFEATLVTKDGKILPFERLSA
GEKQLLATSLLWGLARASGRPVPTIIDTPLGRLDSSHRKHLIERYFPNASHQVLLLSTDEEIVGTYYKEL
KPFITRTYLLEHNEEAGQTNLKQGYFNV

HomologueDndD
OrganismCandidatus Pelagibacter ubique HTCC1002
Locus tagPU1002_00510
PID2055
GID1055
length654 aa
DEFINITION hypothetical protein PU1002_00510
gi 91763094
other link ref: ZP_01265058.1
SequenceMIFENLLINNFGVYSGKQNFDLSTKEKKPVILIGALNGSGKTTFLQAIDFVLYGKFSNFFYSQKLSYENF
LKKNINKNNYDEGAQVELVFYRKYKGKDEKFKISRNWKAIGKKIKEEFFVFIDDVYDEDITKDWDNFVDQ
ILPSRVASLFFFDGEKIEQLADLEQSKGVLKKAINSLLGLEIVDQLNIDVDEFQKRSVLQLKTDDEKKNI
NKLKKEVDEFEDRIKEIDKSIVKVEDELAKKAYDIRELNVVLSQKGISYYEKKQEYEKELQVIDEKRTEI
SDELVKLASGDLPLLVVKNELATMVDQSKSLLENQNKTDSQKKNNDLIESISSFVLKNSKDDKFTKNFEK
FVSDKKINDTTILDNENLLPNLNYQDLNSLLNHNLDTAEKDIKKKINTINKLEEEYEKISQLINKIPTDD
EIKPLIDKLEEHQKDEAKLITKKNILDEQRGQINGPLIKINIELKKEYEKKTTQDLVNLDKKRFVDYSVR
IKDVLSTFHVKALDFHIKRLEKLILECFKRLHRKKDFIKSIKIDTSTFDLQIFEAKNVQVDTDILSAGER
QLLAVAILWGLAKASSSAAPTVIDTPLGRLDSEHRLNLVEQYFPTASKQVILLSTDEEINQKYHKYMKPY
LARSYKIEYDEKINGSKSTLGYFF

HomologueDndD
OrganismRoseobacter denitrificans OCh 114
Locus tagRD1_0800
PID2056
GID1056
length650 aa
DEFINITION hypothetical protein RD1_0800
gi 110678157
other link ref: YP_681164.1
SequenceMILQSLCLTNFGLYGGEHRFDLAPEPDGQKPVVLVVGHNGAGKTTFLESVRLALYGKRALGARVGQAEYE
RHLLKRINNFAKDRIASVELAFTSQHLGNEDLYTVRRSWAARGASVIESLEFERNGAPVEDIPSEDWNHY
LEDIIPAGVSQLFFFDGEKIQDIADDQESTGLTDAIKSLLGIDILDQLRGDLALYKSRSMDRDGDTGLEG
LRRDLEVAKSDLVLAEEEIGSLSAKRTQLARRSEVSQKVFEQEGGSIALSRDTLSEELKRVEAELTKQTN
ALKTRVNGVAPFALAPNLLERFSADLEKARGQQSATAIEAFVSSFQAAVGKSDETWTKAHFAQLKDFARN
RQSTGPRMALSTEPDWVLAKLSQIADERVKVATLAAQLAELQKQRTTLKDQLKNFRPGAASGAFEELKKA
EFELGAIETELNRKQGEATQARALIERLERELRKSQDAVFALAKAEEKRDLATRAQAALNEYEERIVQLR
LASLSKHFIEAFSGLVTRKSLVHDVIVDPNSFQLKLMGRDGREITPSELSAGERQLFAISMLWALGRTSG
RELPMIIDTPLSRLDRKHRTNLMANYVPRSSAQVVMLCTDTELTPDLSKIIKPYVSRRFEIGTVGGGQRT
KITVLSTEAEAQVLETTDAH

HomologueDndD
OrganismMesorhizobium sp. BNC1 plasmid3
Locus tagMeso_4571
PID2057
GID1057
length671 aa
DEFINITION SMC protein-like
gi 110347357
other link ref: YP_666173.1
SequenceMILRSIRLEDFGLYAGVTDLDLVPRQRLGGPTPIILIGGKNGAGKTTLLEAVRLALYGRRALGARVSQAD
YEAYLRQRINRDATTPAAAVALEFDYAEAGTVHRYRVRREWAVRGKSLVESLLLDKDGAAIASVPREEWH
HFLQELIPPGVSQLFFFDGEKIGEIADAEEDNEQLAEAVRGLLGIELVGRLRTDLGLYLARHQRDDDGEL
VTRLENLLRDISVAERQATVLGDEVAEFTSARDSQARAAEQVRRRFVAEGGDAAVHRVRIEAEREEVRRA
MHRSEHELRDLANKLLPFSMAPKLIGAFRKALSRVSGGDATAMSTEALEKALVAWRTGDGPKRNAAWSEK
HWTDLRRFMEAHSGRAALAVTSPAFREVGDGTAALTRLAEVETVVRPRALALLDEFDALARRSRELEVML
ARADNAASGIMLDELRLADQRVGSTESLLKGKQEELKLLRGQLVTMERERRRLLEEQAGSDAATHRAELA
SRTAQALADYEHRLLDHKLTQLRAEFVRCFNHLVRKVDLIADVRIDSASFAATLIDAAGREVPKAALSAG
EKQVYAIAMLWALARTSGRPLPMIIDTPLARLDSEHRANLVGRYFPAASHQVILLSTDTEIDDHLVGDLQ
ASVSHAYRLDYDPASGRTVASHGYFADTQTKREGRRALQQA

HomologueDndD
OrganismVibrio cholerae MZO-2
Locus tagA5A_0792
PID2058
GID1058
length669 aa
DEFINITION DNA sulfur modification protein DndD
gi 153824604
other link ref: ZP_01977271.1
SequenceMLITKLTLNNFRVFRGVHEIDLRPAPARLSKTGPVVGTERPIILFGGLNGAGKTSILTAIRLALFGRLSF
SQNLTSNDYVEALAELIHKGVGLGGLQNSASIELEFKYSQNGEESAYKVLRGWQRGKKDYLQLEKNGIPL
SELNYDQCQGFLNELIPTGIADLFFFDGEKIAELAEDESGLVLKTAVRRLLGLDVIAKLKSDLNIFLKKQ
GSQALSQSLKEEMENLDKLRIKHERNAEKLRGEADIVDAQIELVSRDILNLENKLSQSGGAWAKTREDEQ
QKVDALLKEKVELEKQIRMEMETSLPFALAPNAMQRLQTQIKQEQEIKKKQSFGNELDSFLETLRSKYPS
FDTEKAQHAIADSFKAHVGDFDSAKLLLDISDRQANTIDYQLTKLSQDSFARFDEARKRLQVVEEDIDNA
SNNIARAPEQELIQGLFSEVRKLDKKKEKLIIGYYELLENAKRELKLALETARQIQRLHDKHKDESNKDL
SVTNAQSAILLLDKFAEQLTKARVKQLENEFVSSYKKLARKEDVQLTASINPLTFDVELMDEYGIKINRK
AMSAGEKQIYAISILEALGRTSGRKLPIIIDTPLGRLDSHHRDKLVENYFPTASHQVVILSTDTEIDRNY
TNLIQDDIARTYEICFDGKTKSSTIKEGYFWREANKEAV

HomologueDndD
OrganismVibrio cholerae MZO-3
Locus tagA51_B0785
PID2059
GID1059
length669 aa
DEFINITION ATPase involved in DNA repair
gi 153800564
other link ref: ZP_01955150.1
SequenceMLITKLTLNNFRVFRGVHEIDLRPAPARLSKTGPVVGTERPIILFGGLNGAGKTSILTAIRLALFGRLSF
SQNLTSNDYVEALAELIHKGVGLGGLQNSASIELEFKYSQNGEESAYKVLRGWQRGKKDYLQLEKNGIPL
SELNYDQCQGFLNELIPTGIADLFFFDGEKIAELAEDESGLVLKTAVRRLLGLDVIAKLKSDLNIFLKKQ
GSQALSQSLKEEMENLDKLRIKHERNAEKLRGEADIVDAQIELVSRDILNLENKLSQSGGAWAKTREDEQ
QKVDALLKEKVELEKQIRMEMETSLPFALAPNAMQRLQTQIKQEQEIKKKQSFGNELDSFLETLRSKYPS
FDTEKAQHAIADSFKAHVGDFDSAKLLLDISDRQANTIDYQLTKLSQDSFARFDEARKRLQVVEEDIDNA
SNNIARAPEQELVQGLFSEVRKLDKKKEKLIIGYHELLENAKRELKLALETARQIQRLHDKHKDESNKDL
SVTNAQSAILLLDKFAEQLTKARVKQLENEFVSSYKKLARKEDVQLTAAINPLTFDVELMDEYGIKINRK
AMSAGEKQIYAISILEALGRTSGRKLPIIIDTPLGRLDSHHRDKLVENYFPTASHQVVILSTDTEIDRNY
TNLIQDDIARTYEICFDGKTKSSTIKEGYFWREANKEAV

HomologueDndD
OrganismEnterobacter sp. 638
Locus tagEnt638_0470
PID2060
GID1060
length666 aa
DEFINITION SMC domain protein
gi 146310135
other link ref: YP_001175209.1
SequenceMLIKQLVLRNFRVFNGTHVIDLAPRKRQNDDNSRPIVLFGGLNGAGKTSILSAIRLALYGRLAFGPATQQ
QEYVEELSALVHNGSTTGERPSEASIELVFTYNKGGHEAEFTVTRSWKKGKKDQLSLQQDGQLLEELDYD
QCQGFLNELIPHGIADLFFFDGEKIAELAEDDSGNILRTAVRRLLGLDLISKLRNDLMIFVKRQQSSQLA
GSQQQKLAELEEQVKQFAFQTEQILEKADFAKMRIDLLSKEINRYEALLNAQGGAFAQTKAQEKQKVDTL
LKEKDRLEKALRHECDSSLPYALAPKTLERLLEQISAEIQIKQADSFEKELTQFLTQLKNDISFRSGTTG
KIAAEAIEDNLKDYLAGKPKGELLFDISEREAGMIQQSIEKDSKKAWQRFDLYRHQLAEVEEQLEQAAAN
IARAPEDDQLFDIFEKLRELDRKRESKRQEYRSLLEEAKQTKQLQLDCARQVQKTHDLARNQHNSDSAFN
NAQETINLLDRYSELLTQARVKTLSANFEGAYRKLARKEDLQLNAHINPETFDVELVDENASVINRKLLS
AGEKQIYAIAILEALAKTSGRDLPVIIDTPLGRLDSQHRDKLINHYFPFASHQVVLLSTDTEVDERYFVD
QLRDDISHAYEIVFNAHTKSSALKPGYFWELTKEAI

HomologueDndD
OrganismShewanella pealeana ATCC 700345
Locus tagSpea_2307
PID2061
GID1061
length676 aa
DEFINITIONSMC domain protein
gi 157962128
other link ref: YP_001502162.1
SequenceMIIKSLVINNFRVFRGVHEIDLEPRVTRKHQTAASPIVLFGGLNGAGKTSILSAVRVALYGRAAFGRGMN
SAQYQEQLDALIHNGVGISADKASIQLIFTHSQNGVESEYRVTRGWKRGQKDKLVLEQNNTELSSMSYDQ
CQSFLNELIPPGISDLFFFDGEKIADLAEDESGEVLQTAVRRLLGIDVAERLRSDLAIYLKRHDAAAMPD
NIKAQIDKLESDRTAAEHAAVELTNKASLCRAKIELIAKDIEKTELDLSSRGGAWAQSREQEKAKQFELD
AERKELEKTLRAEIEGDLPFALAPNAMQALLTQLEAEKKAKQADSFNSELKGFLTELEQKLSFSLSNSFV
AIETIKECLNDRESQQVKTDIQLDLADREYDQIKAQINNQAPSSYKRFDEARKRLAIVEEQLDSISINIA
RAPEQEQLETQLEALKELNSRRTAAIVEHRDTTEAAKRKYREAIDYARKVQKLHDKHKVASTAEASLTNA
QNTHALLAEFSEQLTAVRVKQLEAEFIKSYQKLARKEDLKLSARINTTTFDVELIDEDQHTISRRGLSAG
EKQIYAISILEALGKTSGKKLPIIIDTPLGRLDSKHRDKLIEHYFPEASHQVIILSTDTEIDEAYFGEDY
LKDDISHAFEIQFDAATKSSKLREGYFWEQNSANNEVQQNSVVGAN

HomologueDndD
OrganismCandidatus Methanoregula boonei 6A8
Locus tagMboo_0358
PID2062
GID1062
length673 aa
DEFINITION SMC protein-like protein
gi 154149903
other link ref: YP_001403521.1
SequenceMLLHSLTLENIRIFKGKNRLDFTPILTSDVKKPIILIGGKNGAGKTTLFESILLCLYGQHAPGSLMSKTK
YEQYIRQIVPRSKKLEAELIPAIEIVFEFTHSGIRNTYGVRREWSLGPKFSENLTITCEGSILSELEKDQ
WQDLLNELIPPRFARLFLFDGEKIQNIVDDNDENNYLQDSFKSLLGLDIVDHLKADLGIYLSRHLRSSDI
SAINKQMKETTSEIGKIEEEKEYLEQERAKVQGQSERVQLEIGKQEQLLASEGGGFARIRDDMKAEKVRL
DQFVVKTENEISELCEGLFPFAITPKYCESLKKTLIEEDKVQAHALSQEIIHANIEELNKIIQSPAFWSD
VSVPSSQKEKVREKLVDLMYQHLVTDDSVKKKKLVHHLSQHEYKQLLQWIEEATKTTPKKMKELSEQLEK
LTAQRLKIAEMINKAPSDEVIAPHITKLNELNQKIGQCSEQLRSINESIRQIDLRLNELNRQRKKFEEEI
QGAKGGSIKMELALQVTTVLNEYAKELQKQKINYLGDNILSCFNRLIRKDDYVQKILIDENYNIILYDAD
GNTIPKNLLSAGEKEIFAVSLLWGLTLTSGRQLPFIIDTPLGRLDSEHRGNLVMDFFQHAGDQMIIFSTD
TEIDKEYFRILQPQIARAYHLDYSKKERHTSISPGYFWQEVES

HomologueDndD
OrganismBurkholderia ambifaria MC40-6
Locus tagBamMC406_0010
PID2063
GID1063
length660 aa
DEFINITION DNA sulfur modification protein DndD
gi 172059076
other link ref: YP_001806728.1
SequenceMAKITISSVSIENFGPFRERQTLALDVEETRPVVLVKALNGSGKTTLLTALQIGLYGYKAIDGMKRSEYE
QLLLGLQRRDALGNAVIEIDVIVEIGGLPRHLRLRREWQKKGSYLTEDLSVLEGGSLNQDFSRSWDEFIG
SILPAELVQLFLFDGERIEALANPERLPELLKRATEVFLGIGGIDALGNDLKALERRAALKNKTSSSEFE
AARSHLETLADQVKVLERALQTLTQEKASAQNAVEQAQSTLDKFANTAQRQGLEAYQQAAALRNADETTR
ARVQEIRASLAEAISDPVLPIAWLPQLWGRYRDAWENDQRARHSKLLGQEFRKRDQRIISRLAASSSKAT
VEAVRRVLAEDLQRQGKPRSASSSALQDASPRDTERQLQHGRERLRDELEKLRLAQAELDRTELLLGQIP
AEEQIGEMLTVLQSHSKAAAAAEAHLASITQRLSETQSHLEHIRTRMNAAHDRLGTNFKDRSLESKSLEA
SVRTRKTLAVFKDRLLASKAHWLSEMITSEFRGLMRKKNLIARVVVDPATYRVSIEDADQHELPMDRLSA
GERQLLAIAVLSALIKERKGRFPVVVDTPLARLDQRHRSTLIKQFFATVSHQVIVLSTDQEVEGVAYEAL
KPFTAAEYTLDFDDAKGCTVINAASVEELL

HomologueDndD
OrganismSalmonella enterica serovar Saintpaul SARA23
Locus tagSentent_010100006020
PID2076
GID1076
length671 aa
DEFINITIONSMC domain protein
gi 167542816
other link ref: ZP_02338392.1
SequenceMNVLIKQLVLHNFRVFCGTHTIDLAPRKRPHEVNPRPIVLFGGLNGAGKTSILSAIRLALYGRLAFGPAM
QQQEYVEQLGALVHNGTYTAERPDEAAVELTFTYNQNGHETEFTVTRSWKKGKKDRLSLQQDGQPRSELS
YDQCQGFLNELIPHGVADLFFFDGEKIAELAEDESGNILRTAVRRLLGLDLIARLQNDLMIFVKRQQTAQ
LGGSQQQQVEALEAKIKTLAGQAEKLLEEADFVNSRIEFLSQDIIRHEGLLNAQGGAFAQTKAQEKQKVE
TLLKEKERLEKALRQECDGSLPYALAPNTLSRLLEKIANEAQIKQAKIFETELNQFLTQLKNDIAFRSSS
ESSTRAIATEAITNNLDAYMATKPKGDLLFDISEREAGMLQQSIEQDSKKAWQRFDMYRHQLADIEQQLE
QAAANIARAPEDEQLMDLFAALRDLDHKREKQRQKYRSLLEEAKRTKQQQLDCVRQVQKAHDITRSQHGL
SSAFKNAQETINLLDYYSNVLTQARVKKLSANFEIAYHKLARKEDLQLNAHINPQTFDVELVDEKGSVIN
RKLLSAGEKQIYAIAILEALAKTSGRDFPVIIDTPLGRLDSQHRDKLINHYFPEASHQVVLLSTDTEVDE
RYFVDRLRDDISHAYEIVFNAHTKSSALKPGYFWELTKEAV

HomologueDndD
OrganismVibrio fischeri MJ11
Locus tagVFMJ11_A0169
PID2088
GID1088
length654 aa
DEFINITIONDNA sulfur modification protein DndD
gi 197336972
other link ref: YP_002157726.1
SequenceMHEIDLRPAPARLSKNGPIEGTERPIILFGGLNGAGKTSILTAVRFALFGRQSFSQVLSNGEYVDALSEL
IHKGVGHGGVQDNASIELEFKYSQNGEENTYKVIRGWKRGKKDNLYLEKDGIQIPELNYEQCQGFLNELI
PTGIADLFFFDGEKIAELAEDESGSVLKTAVRRLLGLDVIAKLKSDLNIFLKKQGAGALSQSLKEEMDNL
ENIRIKHEREADKLRFEAENEVYKQIIHTSSDIQILENKLSQNGGAWAKTREDEQHKVENLLKEKVELEK
QIRMEMETNLPFSLAPKAMQRLQTQIKQEQQVKKKQNFGNELDAFLETLCSKYPSFDTEMAQNAIADSFK
EHVGEFDSTELLLDISDRQANTIDYQLSNLSQDSFSRFDKARVRLSKVEEEIDNASNNIARAPEQEQVQE
LFADVRALDKKKEKLIIEYHDLLEKAKQELRLALETARKIQKLHDKNKDQSSKDQSVSNAQNSILLLEKF
GEQLTKARVNQLENEFVQSYKKLARKEDLQLTASINPATFDVELVDEHGIKINRKAMSAGEKQIYAISIL
EALGRTSGRKLPIIIDTPLGRLDSHHRDKLVENYFPTASHQVVILSTDTEIDRNYTNLIQDDIARTYEIC
FDGTTKASTLKEGYFWKESIKEAM

HomologueDndD
OrganismClostridium botulinum E3 str. Alaska E43
Locus tagCLH_1925
PID2092
GID1092
length719 aa
DEFINITIONDNA sulfur modification protein DndD
gi 188588958
other link ref: YP_001921306.1
SequenceMIINSITLKNFRSYEDKTTFSFTPKGNKNIVLVGGENGAGKSTLFEAIKLCIYGPITYGYLGLNHNYLTK
IKNNINDNAFKNEDIECYVGLSISFKEGTQIKDYYLKRSWNYINQKIHEDFKVSLNDTELNDEDKLYFDK
YLKSVIPPSLFDFFFFDGEELSEFFTGKSACSNLKESILELFNYDTFEVLKKQLLAHQRAKSKSNIKLED
AQNNFDLLSSKVKDLKLEIENLEKTLLLDEELLDTLLVKRNGIEDDFKSSGGLLEGEKAVLNSEIAKIEN
DRTNINVEIKDFCNDKLPFLLVTDLLEETKIQIEKEDSLTSYNSISKKLSGDIVKGALVKHIPPKVKNIN
FNEIAVDLLNNMFNTVELNNVANILELSTEQRNTITHTIDNILNKRNTLTKSIFSKFDSISQIATKLKKL
RSKLNSSISDDILNSYLENLHSINEEINVIQKNLAVKKTTIESKYDELKNKEYHLTRARNEYTTLLQNSN
VLDMSTQLIEYLSELLTNLTKDKITLIENEFIKIFSKIIRKNNYVNSIVIDDNFNTTLYINKDYNSTEIL
NVINNLGFDGLIKKYGDKFLEDLLNHYKVNSHKELKSLISSDISFNYICLSTKININDFSNGEKQIYILC
LIWAIIKSSGVEIPFIIDTPYARIDETHRNSLTTAYLPKISKQVIILSTNKEIDNELYKVVKPYVCDEYL
LLYNTELRKTEVKNGYFEV

HomologueDndD
OrganismCitrobacter koseri ATCC BAA-895
Locus tagCKO_03496
PID2097
GID1096
length115 aa
DEFINITIONhypothetical protein
gi 157147692
other link ref: YP_001455011.1
SequenceMLPNRLQLNIRVEDQLKRLKASTGVNPNISARIAFFRSVESGYRFDGNDYKTDGNMSMDKAVWLGDTGVA
TELILKMLYPNFDGKKMMQAWAAHVDDGSASLRNHRELISFTTSL

HomologueDndD
OrganismMycobacterium abscessus ATCC 19977
Locus tagMAB_1096
PID2101
GID1101
length658 aa
DEFINITIONhypothetical protein
gi 169628190
other link ref: YP_001701839.1
SequenceMILDNLVLENIGTFGGKNEIRLTPSSSKKPVVLIGGLNGAGKTTILEAIHLALYGPLSQARSRRSGSYDT
YLRSLIHHGVPASEGAAVELSFHLFQQGEEHSYRIRRRWQGGGASLQEFVLVWVDGKYDDALTSTWNEHV
ETFIPRGIAGLFFFDGEQIEALADLEQSQHVLKSALAALLGLDLIDRLSTDLAVLRRRHRGAEVPDDLRL
AVEERRKTVTLARQGEEMAATLAATSRVEAERADKRLNEVTEQYRAAGGGLLEQRDAANTRVTLVRQQIA
DLDDELRAEAADTAPFLLVGGLLGDLANHVARERDARRDSLVLSVVGDRDRELLGLLRKAKVRGAALTAL
EEFMASDVASRQDASARVPMVSGLRDGGPVEALHASVLPSTQNRVASLVERRVALAEELVQAERTLVAIP
DPESLASLKQELDEASEAAVRCHALLVQNEDQLEASRQERARADSAYEAAMDKSAQATLDADDDRRLVEH
AERARVTLDELKTKAAERHVSQIGRLVLEALTRLLRKDRLVTDVRIDPTSYTVELVGSDGQSLAATELSA
GERQLLAVALLWGLAQAAGQPLPMVIDTPLGRLDGAHRGRLIERYFPHAAHQVVLLSTDTEVDEAALKSL
RPSVGRMYRLEFDSAVNATTVQLGYFWE

HomologueDndD
OrganismClostridium perfringens NCTC 8239
Locus tagAC7_1518
PID2105
GID1105
length718 aa
DEFINITIONDNA sulfur modification protein DndD
gi 168217095
other link ref: ZP_02642720.1
SequenceMIINNITLKNFRSYEDETTFSFTPNGNKNIVLIGGENGAGKSTLFEAIKLCIYGPTTYGYLGNNYNYQTK
IKNNINDNAFKNEDIESFIGLSLSFKEGTELKDYYLKRIWKYKKHKLNEEFKVFLNDKELSEDDKLYFDK
YLKSVLPPSLFDFFFFDGEELSDFFVGKSSSSNLKEAVLELFNYDTFDVLKKQLLSYQRTHSKENKNLDE
AQARYDELSSEIHEIKNNISELKNIIFNNESILDDLYIKKQNAEDDFRNSGGIFEEERLLLNSQINKLES
ERTEINQEIKDFCNDTLPFLIVSKLLKNTKKQIDEEEALISFNSISKKLSGNIIKSTLNKHLPKHNNVNY
DEIALTLLNEMFELDKMNNISNILELSNEDKNSINFIINNILSKSNDFKFDILSKFTRLKEISLSIKILR
EKLNSTVSGDFLNNYLETTAILNKQISDTENIITSSKAKLEEKYKQLSLKEYHLTRAKNELTSLLQNNNV
LEMSSSIISYLDKLLKNITRDKIDAIEEEFINIFKNIIRKDNYVNSIVIDDSFNSTLYINKEYDTNEILN
ILTNLGFEGTEKKYGSKFIDDLFKYFNVLDYKNLTKKLEQIALVEYISLSSKVNINDFSKGEKQIYILCL
IWAIIKSSGVEIPFIIDTPYARIDETHRNALTTTYLPNISKQVIILSTNKEIDSDLYQVVKPYVCNEYLL
LYNTNLRKTEVKNGYFEV

HomologueDndD
OrganismExiguobacterium sp. AT1b
Locus tagEAT1bDRAFT_1708
PID2109
GID1109
length670 aa
DEFINITIONputative ATPase involved in DNA repair
gi 187605119
other link ref: ZP_02991321.1
SequenceMKIESIVLKNIGAYKNQTFDFKNENSNKNVILIGGKNGAGKTTFLNALRTGLYGSQAFGIKAPTPSYFKE
IEKLINSEVRDQRERYSTTKQISKIQITFTTTTNQTTSRYLFERSWGIDAKNIKEYFNIYRDANTFALAE
KDKSQVYSLFLERTPLYLFNVSLFDGETINQIINEGKLSEYLDDLMKSAFKLEIPDLLTETIESLVRDEA
KTKLSKDKSKRLDELKKQLSESEQKLQNVQVDKSQLLQNIEVSEAEITAFSESLRAHDVISKEEEAKLKE
EIRNLEQERQKLKQSTSDFFNEYYAFSINHHLLEKAAEQVESELLIRSVEDLEKVFTDEFYKNVSRNLGG
SVGHDSLKNEFNAALKTAVPKTEIIHDASFGSKAKVENMISSVNAQSSSSLLANINRDDEIIEELKILRR
KLVIREENHADFEKQFEELNQLKVSHLHLNEQLERIVKLEEDLQNQYSMLVEENASLQQEIEKITSKSSL
LSQNATSTLALLEDFKLQQRYKVIRSVEENALRMLKTLMRKEDYVDKLSILPEDFSLTLSSKDQSQISVA
TLSSGEKQILLLSLIWAIFKVSENQMPFIFDTLLGRLDRDHRYNILRNLLPNFGEQVLVLSTDSEISKDY
YDVLKPSISKEYSLQFDNEHLETRVIPSYFEFENAQVKNS

HomologueDndD
OrganismDesulfatibacillum alkenivorans AK-01
Locus tagDalkDRAFT_5061
PID2113
GID1113
length659 aa
DEFINITIONhypothetical protein
gi 163722440
other link ref: ZP_02129978.1
SequenceMIIDEITLHNFGVYGGRHCIKLTPPSADKPVILFGGLNGAGKTTLLDALQLVLYGKLASCSNRNGQSYDD
FLFSSIHRKAAPHEGAALEILFRHNLNGREQSIRVNRSWVHNGNRLKEYLEVERNGSIDRVMADTWEDYV
QDIIPSRVANLFFFDGEKIETFANLDNAKKILSTAIHALLGLDIIDQLKNDLKVLEKRKQKAGVSTANRS
KLSVLESEITALDDEIDSKAQRRAGLQNDLDKKYIQLKDIEELFSRSGGKLFEQMKKIESDKIKAEESLK
ATETILRDLASDSLPLFMVGKLIDDIRIQDLAEQDYKKNCLLNDFIKKRDEQIIKTLIRAQASKKILQAI
DHFFEKEGAQRANSIGPSDIFLNLSDKTRNYVHNNYADEMKTSVLRTKTLIDQISEIQNDIDDLDRKIAA
SPPQDAVITIIENRERVSLEIRNLEELIERLSQELENLKRRKTILKDSLTTTIKRVVEEDFGSEDIRRAI
SHSKRVRKTIDSFRSMVLQSHVDHISNMILESFKQLIRKEHLVDQISISPDDFTLHLYGQDKEAIKPTRL
SAGERQLLAASILWGLARASGRVIPAVIDTPLGRLDSEHRTHLIDHYYPHASHQVVLLSTDEEITEKYLD
RIMPVVGRSYILEYQDEADTTAIREGYFW

HomologueDndD
OrganismEscherichia coli SE11
Locus tagECSE_4577
PID2116
GID1116
length681 aa
DEFINITIONhypothetical protein ECSE_4577
gi 209921768
other link ref: YP_002295852.1
SequenceMNPLFWSRRKTNVLIKQLVLHNFRVFNGTHTIDLAPRKRPHEVNPRPIVLFGGLNGAGKTSILSAIRLAL
YGRLAFGPAMQQQEYVEQLGALVHNGTYTAERPDEAAVELTFTYNQNGHETEFTVTRSWKKGKKDRLSLQ
QDGQPRSELSYDQCQGFLNELIPHGVADLFFFDGEKIAELAEDESGNILRTAVRRLLGLDLIARLQNDLM
IFVKRQQTAQLGGSQQQQVEALETKIKTLAGQAEKLLEEADFVNSRIEFLSQDIIRHEGLLNAQGGAFAQ
SKAQEKQKVETLLKEKERLEKALRQECDGSLPYALAPNTLSRLLEKIANEAQIKQAKNFETELNQFLTQL
KNDIAFRSSSESSTRAIATEAITNNLEAYMAAKPKGDLLFDISEREAGMLQQSIEQDSKKAWQRFDMYRQ
QLADIEQQLEQAAANIARAPEDEQLMDLFAALRELDHKREKQRQKYRSLLEEAKRTKQQQLDCVRQVQKA
HDITRSQHGLSSAFKNAQETINLLDYYSDVLTQARVKKLSANFEIAYHKLARKEDLQLNAHINPQTFDVE
LVDEKGSVINRKLLSAGEKQIYAIAILEALAKTSGRDFPVIIDTPLGRLDSQHRDKLINHYFPEASHQVV
LLSTDTEVDERYFVDQLRDDISHAYEIVFNAHTKSSALKPGYFWELTKEAV

HomologueDndD
OrganismEscherichia coli 55989
Locus tagEC55989_4839
PID2121
GID1121
length682 aa
DEFINITION putative ATPase involved in DNA thiolation
gi 218698029
other link ref: YP_002405696.1
SequenceMSMPANPLYWSARKTNVLIKQLVLHNFRVFNGTHTIDLAPRKRPHEVNPRPIVLFGGLNGAGKTSILSAI
RLALYGRLAFGLATQQQDYIEHLSSLIHKGAYYIEQPEEAAVELTFTYNKGGQESEFTVTRTWKKGKKDR
LSLQKDGQPLSELDYDQCQGFLNELIPHGIADLFFFDGEKIAELAEDESGNILRTAVRRLLGLDLISKLR
NDLMIFVKRQQSSQLAETQQQQIEVLEKQSRDLACQTEALLEKADFAKSRIEFLSKDIIRYEGLLNAQGG
AFAQTKAQEKQKVETLLKDKERLEKALRQECDGSLPYALAPNILSELLEKIADETQIKQAQSFEKELRLF
LAQLRNDIALRSRTTSKIAAEAITDNLNEYMATKPKGDLLFDISEREAGMLQQSIEQDSKKAWQRFELYR
IQLAEIEQQLEQAAANIARAPEDEQLMDIFEKLRDLDKQRENQRQKYLSLLEDAKRVKQQQLDCVRQVQK
LHDAARSQHGFSSAFKNAQETINLLDRYSDVLTQARVKTLSANFEVAYRKLARKEDMQLSAHINPETFDV
ELIDEKGSVINRKLLSAGEKQIYAIAILEALAKTSGRDLPVIIDTPLGRLDSQHRDKLINHYFPFASHQV
VLLSTDTEVDERYFVDQLRDDISHAYEIVFNTHTKSSALKPGYFWELTKEAI

HomologueDndD
OrganismClostridium asparagiforme DSM 15981
Locus tagCLOSTASPAR_00198
PID2125
GID1125
length712 aa
DEFINITIONhypothetical protein CLOSTASPAR_00198
gi 225386451
other link ref: ZP_03756215.1
SequenceMRINEICLYNFGSYEGLNRILCNVEDKKKNIVLFGGKNGAGKTTLFTALQISLYGSRAYGYAANNAFYNR
KIEKLINNKAKMTRPAISYVELKVEISNGLEIDQYKLNRKWTLDEVNVLSEEYTVCKNEMLLSESEINDF
DAFIMQIIPPELFNLYFFDGEKIVDFFLSEGSNKRIKKAFMTLCGYDAFEIMHKNFKRVNSSNIENDLLK
QQYWELDEKIADMAKQCGNLTECQENLKKECETVQAKVILLDAEYKKNGGVSEQEWSRKFEQIKEEEYLR
DRSKTQLKEIANDTIPFLILKTQMEKVHKQIMRELERERAEKFLELLSSDNSRDTFRGFFKRNHLQVTEE
QEQELITDFTNYYEEHFLCDQPILQLSNDEMASFLNVWNRIKIFDVKSVENLTKAIKASLKKSQTLRKEI
ELCNVNTVSDYVERRSELLKKIDSLKMKQFECEQQLFQVEWEKQSCEAEYKRIEKAYMEELKADSVRDIS
GSAMVMLSHLQETLLKSKINKVETAFRHEINRLIRKEPFIDDIVIDSDFNIVVYRNITYPEDELIEIINK
SGTKNVVNTFGERAAKILFSYKTESQSLSLAGAIRGKHEITLPIELDKNSFSSGEKQIFIMAFYRAIMKL
CNQEIPFVIDTPFARIDTEHRYNIVNYFFKELKGQVFILSTDEEISEEHVAMIEDRLAASYTLVNTDDSR
TTLVANKYFGDT

HomologueDndD
Organismgamma proteobacterium NOR5-3
Locus tagNOR53_2579
PID2130
GID1130
length652 aa
DEFINITIONDNA sulfur modification protein DndD
gi 219674931
other link gb: EED31298.1
SequenceMLFTELVIHNFGIYRGRHTVDLRPKSLGQPIILFGGLNGGGKTTFLDAMKLVLYGKFAECSNRGSQSYDQ
YLANTINRHCPPNEGAAIELEFTIYRASEETTIRVKRFWQKMKTVSEKVEVLENDAHNPFLSEHWLDHVD
EFIPQEIANLFFFDGEKIEALADKKRSGSIVKTGIDSLLGLNQVSKLESDLDVLDRRRTTTTADVKLKRD
IEECQSKLAHLTTERQDTTNRIGTLGSEIEQLENRLRDQRKKLRDLGGHLLENRERNEQDLEKVEASLAE
SRLSMRELASGVAPILLIEKIVSRAKDQSEREAQSKRSKEFLKQAQDRDKALLDFLDQTNANAVSESIRD
WLANDIELRSPSNEEPSYLDTESAIFEKLEGDVTGFVRKRAKELVEATSRLEAEKEHLQQQLAAMPNEKK
AHSVIIEIKNLEAQLTQNTAKLAVQKEGHQTAKKQIEKIEEREFKLNTALIEAKYADQKIELMNKRSKLV
KQTLRSYKSKILSAHISKLETLIFDSFTSLVRKHALISCVKIDPDTFEITVFDSDNVALPTDRLSAGERQ
LFAIAILWGLAKASGRPLPSIVDTPLGRLDSQHRTHLVENYFPYASHQVILLSTDEEIDQRYRDKLSKFI
GKEYHISYSQEAKTSTITPGYF

HomologueDndD
OrganismAcidobacterium capsulatum ATCC 51196
Locus tagACP_3184
PID2134
GID1134
length655 aa
DEFINITIONDNA sulfur modification protein DndD
gi 225874730
other link ref: YP_002756189.1
SequenceMTFLEIDLENLGPFRGRHAIKLAVSSPRNIVLIGALNGSGKTTLLNAFQLALYGRDSLPGRSAKNYQQYL
RHLINNQAALHESASITLTLILDDLADDCHIRVERRWWRSQNNEVREQLTVWKGSEASDDLTQTWDTFIA
SILPARVADLFFLDGEKIEALTAPDQAASIIRKGIFTLLDLDRIEELRANLRVVKRRRLNSIEGEENSDE
IRVLEGKVAESLEKRSTLAQERASLTNVLDRANMRVLNAERTFREGGGELFERRERWVRRQTELHAASRH
TSDQLRQIAGRELPLLACSALVDQGIDAVRRSDEAQRLSITIEAIRARDKEYVRILRELQLPASIGKEIA
AELAHTVPTIPSNTPPTSFGIRSERLERYSAAQRKRLNKDVSALLKESEKQKNELAEVDQAIEAVPSEEQ
IAELTWELKDANAELARVQAAMANLDDQIERWNRQIEDARKNLDSALGTRLKQGISNAEAERVVRHIELV
DRSLQEYLVKMVERHSGDISSKILASFRLIARKPELLSGLKIDPHTFHMSLTGNSGKHIDPGELSAGERQ
ILAFAILDGLAKSSGRQIPTLIDSPLGRLDGIHRQRIAQHYLPSASHQTIVFSTDKEVDEQMLRMLNHNI
AASYLLNFNEKAYGTEIKNGYFQAG

HomologueDndD
OrganismTolumonas auensis DSM 9187
Locus tagTolaDRAFT_2704
PID2137
GID1137
length671 aa
DEFINITION DNA sulfur modification protein DndD
gi 223578870
other link ref: ZP_03620382.1
SequenceMLITKLSLNNFRVFCGLHEIDLTPSSAAHNAKGEEIPGTERSIILFGGLNGAGKTSILTAVRLALYGRLS
FGKPLHNNEYIEELSELIHKGNGINSPENAYIELAFTHNQAGSENTYKVTRSWKKGKADKLILEQDGKDL
SELSYDQCQGFLNELIPNGIADLFFFDGEKIAELAEDESGTILNTAVKRLLGLDVIAKLKSDLNIYLKKQ
GATLLETSIKQQLDNLDETRIKHERNAEKLRHEANQVLIQIEHVSQEIQKLEAELSSSGGAWAETREQEE
QKIDQLLKEKLELEKQIRMEMETSLPFALAPNSMKALLSQIEKERALKQKQHFAKELDGFLDTLRKDLSF
RLADSNVAMDAIADCFNYYVSDDSNQALLLDISDRQANAIEYQVNQSSHRSYERFDKARSRLGQVEELLD
NISQNVARAPEKEQLQGTLDKIRARDKKKQELCSDYQALLEDAKQELRLALETARQIQKLHDKHRDNANK
NASVENAQNTILLLSKFADQLTKSRVKSLEQHFVESYKKLARKEDLQLCALINPKSFDVELIDEHGNKIN
RKAMSAGEKQIYAISILEALGKTSGRKLPIIIDTPLGRLDSHHRDKLVENYFPTASHQVVILSTDTEIDK
DYIRLIEDDIAKTYEICFDGKSKSSHIKQGYFWKQVIQEAV