Summary Sequence Alignment 16S rRNA Context  

31 homologues found:

HomologueDndE
OrganismStreptomyces lividans 1326
Locus tagSLG76
PID2064
GID1064
length126 aa
DEFINITION conserved hypothetical protein
gi 145244341
other link gb: ABP49152.1
SequenceMPSEITIRLSQAAKDQLSWLKRHTGLTQWNELCRWALALSLRDPSTPLVREIITDSNVEIAWKTFAGPHG
DIYLALLKQRCVADGDEPTDAAVGKTLLIHLHRGIGFLAGRQDLRSIQNLIAVTAE

HomologueDndE
OrganismStreptomyces avermitilis MA-4680
Locus tagSAV_2929
PID2065
GID1065
length131 aa
DEFINITION hypothetical protein SAV_2929
gi 29829471
other link ref: NP_824105.1
SequenceMQEPRMPVDHVRLSQPAKDRLSYLKRTTGVTQWNVLCRWALLLSLRDPSTPLVKDIVTDSNVEMSWRTFA
GQYGDLYLALLKQRCVAIGEEPNDENIQRVLTVHVHRGIGYLGADKQMATVEGMVGAVVPT

HomologueDndE
OrganismPseudomonas fluorescens PfO-1
Locus tagPfl_0741
PID2066
GID1066
length119 aa
DEFINITION hypothetical protein PflO1_0741
gi 77456968
other link ref: YP_346473.1
SequenceMIIDRIRLTAAAKVQLSTLKRRYGLEHNNTICRYALCMSLATPGELIQEELSFLGGLEIDWKTFTTGNED
FYINLVKAWSENNAQHVDDESIKRYITLHVHRGLSFLSGRSERLEFMLE

HomologueDndE
OrganismPseudoalteromonas haloplanktis TAC125
Locus tagPSHAb0095
PID2067
GID1067
length123 aa
DEFINITION hypothetical protein PSHAb0095
gi 77362016
other link ref: YP_341590.1
SequenceMNTTLQTIDSIKLSEKQKQQLVRLKSKTGIENWNVLCRWALCMSLAEDSIPPVEEIPSDSNVEMSWKVFA
GEYADVYLAVLREAYQKQSAHLEGVHFGDFLKLHLNRGISFSLSFPSYKCKGL

HomologueDndE
OrganismHahella chejuensis KCTC 2396
Locus tagHCH_07045
PID2068
GID1068
length111 aa
DEFINITION hypothetical protein HCH_07045
gi 83649650
other link ref: YP_438085.1
SequenceMLPQKMKISEKAFTSLRRLQNNTGLTVNIGARLAFFASIERGFTWNGDDIQLTQRELDKYSWLGDHGDII
EMLLKQKYPNLDNKDYYKAWAIHVDDGAIVIENKSSLESLM

HomologueDndE
OrganismOceanobacter sp. RED65
Locus tagRED65_14692
PID2069
GID1069
length112 aa
DEFINITION hypothetical protein RED65_14692
gi 94499778
other link ref: ZP_01306314.1
SequenceMLPNEMKITDNAFHSLRRFHSNTGITINIGARLAFFKSIESGYTYDGREMEPRQRSLSKHVWLGELEQVV
ELLLKDKYPDMHQKELYKAWNAHVEDGSASIEGKTNLSSFLE

HomologueDndE
OrganismBacillus cereus E33L
Locus tagBCZK0831
PID2070
GID1070
length126 aa
DEFINITION hypothetical protein BCZK0831
gi 52144392
other link ref: YP_082435.1
SequenceMNYRLKISKRVSDKLKELQAPTNLTPNILARLAVGLSLTDPTFPEVLTDKEAGGLEINRHTLTGEYDFIY
KCLITQHAGREVSDNEYFPTLFNAHLERGINLLDSEYKHAGNNEKFTMNLLKYGKE

HomologueDndE
OrganismCandidatus Pelagibacter ubique HTCC1002
Locus tagPU1002_00515
PID2071
GID1071
length127 aa
DEFINITION hypothetical protein PU1002_00515
gi 91763095
other link ref: ZP_01265059.1
SequenceMDFYIDQLRTSTHLKNILTRVRSRTGIQNMNVICRWGFCLSLKQTSLPRDIDEKLDGVTIDYDTFAGKNK
IIYTQLLVNNMVKHNVEITRRSLAKYLNSHVNRGINIIYNNKLKSIVGLLKLTNSKS

HomologueDndE
OrganismRoseobacter denitrificans OCh 114
Locus tagRD1_0801
PID2072
GID1072
length124 aa
DEFINITION hypothetical protein RD1_0801
gi 110678158
other link ref: YP_681165.1
SequenceMHINKFRISSTATGQVRIISQRSGLTPNLVCRMAMLSSFEAGPISGAADDAGEGQEFNAYTLFGDFQPLF
IDLLKYVEFGAEEIETDDSDLLARLRLHIDRGVRQLSVRLKSPADAAELIAGSA

HomologueDndE
OrganismMesorhizobium sp. BNC1 plasmid3
Locus tagMeso_4570
PID2073
GID1073
length125 aa
DEFINITION hypothetical protein Meso_4570
gi 110347356
other link ref: YP_666172.1
SequenceMHYSKLRISADATSKLRSLRQRTGVTPNLLCRMAIMTSLEEGPLGGAAIPDEDGSEFNAYTLTGEYGALI
AAFLRFVEEGQEPDPPLEDEILLDRLRGHIHRGVGTLSVRAKSPADILRLVPTSA

HomologueDndE
OrganismVibrio cholerae MZO-2
Locus tagA5A_0791
PID2074
GID1074
length115 aa
DEFINITION DNA sulfur modification protein DndE
gi 153824532
other link ref: ZP_01977199.1
SequenceMLPNRMNLTRTTEEQLKKLKGYTGITPNVSARIAFFRSIESDFRYQGQEAKLDGSLVLDKYTWLGETSDV
TELVLKMYYPELDAKEYQQAWAAHVEDGIASIRNIKTILNLSERI

HomologueDndE
OrganismVibrio cholerae MZO-3
Locus tagA51_B0784
PID2078
GID1078
length115 aa
DEFINITION DNA sulfur modification protein DndE
gi 153800606|
other link ref: ZP_01955192.1
SequenceMLPNRMNLTRTTEEQLKKLKGYTGITPNISARIAFFRSIESDFRYQGQEAKLDGSLVLDKYTWLGETSDV
TELVLKMYYPELDTKGYQQAWAAHVEDGIASLRNFKNIEKLSNTL

HomologueDndE
OrganismEnterobacter sp. 638
Locus tagEnt638_0469
PID2079
GID1079
length112 aa
DEFINITION DNA sulfur modification protein DndE
gi 146310134
other link ref: YP_001175208.1
SequenceMQLSRQTEEKLKKLKGYTGITPNVVARLAFFRSVESEFRYSPERDSKKLDGVLVLDKITWLGETLQTTEL
VLKMLYPQLEQKMLIKAWAAHVEDGVAAIRNYKNLKSITQAL

HomologueDndE
OrganismShewanella pealeana ATCC 700345
Locus tagSpea_2308
PID2080
GID1080
length122 aa
DEFINITIONDomain of unknown function DUF1832
gi 157962129
other link ref: YP_001502163.1
SequenceMLPNRMNLTRSTEEQLKKLKQYTGIAPNVSSRIAFFRSIESGFIYRPADSIDTEAKLDGSLVLDKVTWMG
ETQLVSEQLLKLKYPTLEGRSLMSAWAAHVEDGIAAVRNHKKINELSNAIVT

HomologueDndE
OrganismGeobacter uraniireducens Rf4
Locus tagGura_2476
PID2081
GID1081
length132 aa
DEFINITIONhypothetical protein
gi 148264521
other link ref: YP_001231227.1
SequenceMRPPVEHVRVSTKGKEILIKIKRRTGLEHWNEVCRVALCHSLSNPTSPPKLERVSDSTIDIEWKTFAGQY
QKEFAAMIMLRSKQHGININDREEIAQYFRSHLERGIVSLQTSKDVSSLFHYSQHFELKDNP

HomologueDndE
OrganismBurkholderia ambifaria MC40-6
Locus tagBamMC406_0009
PID2082
GID1082
length128 aa
DEFINITIONDNA sulfur modification protein DndE
gi 172059075
other link ref: YP_001806727.1
SequenceMKERIKLTAAARNQLVTLKRRTGIEHNNAICRHALCISLANPSIPPSEALSFNGGIEMDWRTLTGGEDAL
YHNLLVARLLSEGRRVTDASIQEIFLLHVHRGLSYLVSRRDSDLLIEMAKSLLAVGAH

HomologueDndE
OrganismSalmonella enterica serovar Saintpaul SARA23
Locus tagSentent_010100006015
PID2083
GID1083
length117 aa
DEFINITIONhypothetical protein
gi 167542815
other link ref: ZP_02338391.1
SequenceMLPNRMVLSRQTEDQLKKLKGYTGITPNVAARLAFFRSVESEFRYSPERDSKKLDGSLVLDKITWLGETL
QATELVLKMLYPQLEQKILIKAWAAHVDDGIAALRNYRSLKDFSKNI

HomologueDndE
OrganismEscherichia coli B7A
Locus tagEcolB7_01009999_dndD
PID2084
GID1084
length117 aa
DEFINITIONhypothetical protein
gi 
other link :
SequenceMLPNRMALSRQTEDQLKKLKGYTGITPNIAARLAFFRSVESEFRYSPERDSKKLDGTLVLDKITWLGETL
QATELVLKMLYPQLEQKALIKAWAAHVEDGIAALRNHKSLISLLNAI

HomologueDndE
OrganismCandidatus Methanoregula boonei 6A8
Locus tagMboo_0357
PID2085
GID1085
length141 aa
DEFINITIONhypothetical protein
gi 154149902
other link ref: YP_001403520.1
SequenceMRSSFYRLRISEKATFRLSQLKGKTGLTPNIICRIAICYSLNDPSIPNPADYDERGQEINRYSLTGEWDT
FFIALVKERCIHDKLDPEEDLYDQLRAHLNRGVFGIFPQIKSLGDFRILLVHQAAGIKSGMLSEGHSHGK
N

HomologueDndE
OrganismVibrio fischeri MJ11
Locus tagVFMJ11_A0168
PID2089
GID1089
length115 aa
DEFINITIONDNA sulfur modification protein DndE
gi 197337635
other link ref: YP_002157725.1
SequenceMLPNRMNLTRSTEEQLKKLKGYTGITPNVSARIAFFRSIESDFRYQGQEAKLDGSLVLDKYTWLGETSDV
TELMLKMYYPEFDTKEYQQAWAAHVEDGIAALRNHKNLLGLSINL

HomologueDndE
OrganismClostridium botulinum E3 str. Alaska E43
Locus tagCLH_1926
PID2093
GID1093
length129 aa
DEFINITIONconserved hypothetical protein
gi 188588488
other link ref: YP_001921307.1
SequenceMGFRLKTSKKTKEIFEEVGKSANLKPFALSKIAVSLSLKDKTSILEYKNNDTNGLELQRATVTGEFDAIF
KALIEVNLGRNINDDEYYPHFMKLHIDRGAELLLSQYKYSGGNLEKFLKNALKKGDANL

HomologueDndE
OrganismCitrobacter koseri ATCC BAA-895
Locus tagCKO_03495
PID2097
GID1097
length115 aa
DEFINITIONhypothetical protein
gi 157147692
other link ref: YP_001455011.1
SequenceMLPNRLQLNIRVEDQLKRLKASTGVNPNISARIAFFRSVESGYRFDGNDYKTDGNMSMDKAVWLGDTGVA
TELILKMLYPNFDGKKMMQAWAAHVDDGSASLRNHRELISFTTSL

HomologueDndE
OrganismMycobacterium abscessus ATCC 19977
Locus tagMAB_1097
PID2102
GID1102
length130 aa
DEFINITIONhypothetical protein
gi 169628191
other link ref: YP_001701840.1
SequenceMSIEHIRLTTTARDQLVTLKRRTGITQWNVLCRWALCRSLGESAPPPVAKLVFDSNVEMTWRVFAGEHGD
ELLALVRYRCHVDGLATDDDTIGQQLRLHLHRGIGYLVGDPRVTNIAGLASLVLEQPPAA

HomologueDndE
OrganismClostridium perfringens NCTC 8239
Locus tagAC7_1519
PID2106
GID1106
length129 aa
DEFINITIONconserved hypothetical protein
gi 168217094
other link ref: ZP_02642719.1
SequenceMGFRLKTSKKTKEIFEELGGSSNLKPFALSKIAVSMSLNHETPIEEYESKDTNGLELQRATVTGEFDAIF
KALIEMNLGRHISDDDYYPTYMKLHMDRGAELLYNKYKYSGGNLEKFITKILDEGDASI

HomologueDndE
OrganismExiguobacterium sp. AT1b
Locus tagEAT1bDRAFT_1709
PID2110
GID1110
length126 aa
DEFINITIONprotein of unknown function DUF1832
gi 187605120
other link ref: ZP_02991322.1
SequenceMNYRLKLTEQTHLYFKEIANSTHITPNILARFAVGISLKNEKTPSSVKGQPISNFEINRATLTGEHDEMF
KMMILQHAKRHIEEERYFPDYFNAHITRGAEELYQMFQFSRSTNQFLRELLALQEG

HomologueDndE
OrganismDesulfatibacillum alkenivorans AK-01
Locus tagDalkDRAFT_5062
PID2114
GID1114
length128 aa
DEFINITIONDomain of unknown function DUF1832
gi 163722441
other link ref: ZP_02129979.1
SequenceMAIENIRLSEEAKSRLTRIKTRTGVTQWNVLCRWAFCLSLAEESVPAPANIPSDSNVEMKWKVFGGEHHE
LYLALLEQRCKKDGFEISNEVINEQFKLHLHRGINYLFSNKDASSIKDMLMITLNMND

HomologueDndE
OrganismEscherichia coli SE11
Locus tagECSE_4576
PID2115
GID1115
length117 aa
DEFINITIONhypothetical protein ECSE_4576
gi 209921767
other link ref: YP_002295851.1
SequenceMLPNRMVLSRQTEDQLKKLKGYTGITPNVAARLAFFRSVESEFRYSPERDSKKLDGSLVLDKITWLGETL
QATELVLKMLYPNLDQKLIIKAWAAHVEDGIASVRNHRNLRDFLISL

HomologueDndE
OrganismEscherichia coli 55989
Locus tagEC55989_4838
PID2122
GID1122
length118 aa
DEFINITIONputative DNA thiolation protein; putative phage protein
gi 218698028
other link ref: YP_002405695.1
SequenceMLPNRMVLNRQTEEQLKRLKGYTGITPNVAARLAFFRSVESEFRYSSERDNRKLDGSLVLDKITWLGETL
QTTELVLKMLYPQLAQKDMVKAWAAHVEDGIAALRNHKSLLNFIKSID

HomologueDndE
OrganismClostridium asparagiforme DSM 15981
Locus tagCLOSTASPAR_00199
PID2126
GID1126
length125 aa
DEFINITIONhypothetical protein CLOSTASPAR_00199
gi 225386452
other link ref: ZP_03756216.1
SequenceMITKIKTSKKTMEIFRSIENGIQLQPFILAKLALAMSLKEERDWTDDDFKTDNLGIELNRQTITSEYDTI
FKCLIQMKEKRHLGDDEYIKVYLKAHLDRGAKLLESEFKYSVDFLPHLLKQDKGL

HomologueDndE
OrganismAcidobacterium capsulatum ATCC 51196
Locus tagACP_3183
PID2135
GID1135
length140 aa
DEFINITIONDNA sulfur modification protein DndE
gi 225874729
other link ref: YP_002756188.1
SequenceMAQKSKTDTFKPGDPFPIDTIRVSERAKQQLITLKRNTGIEHWNVLCRWALCVSLQEPSKPPIEGESALS
SLEMHWKTFAGHEEDAYKAVLLARVIKDFGTVSPSLISTQFRLHLHRGISRLAGKKIRSIEDLVRVAVDA

HomologueDndE
OrganismTolumonas auensis DSM 9187
Locus tagTolaDRAFT_2703
PID2136
GID1136
length115 aa
DEFINITIONDNA sulfur modification protein DndE
gi 223578869
other link ref: ZP_03620381.1
SequenceMLPNRMNLSLSTEEQLKKLKSYTGITPNISARIAFFRSIESDFRYSGQEAKLDGTLVLDKFTWLGETSDI
TELMLKLYYPNLDGKKYQQAWAAHVEYGISSLRNHKSLLNLGIKL