SecReT4
Protein ID: 116006879
T4SS name [ID]Tra_F [100]
Gene symboltraA
Locus tagpO86A1_p096
StrainEscherichia coli plasmid pO86A1 (NC_008460)
Repliconplasmid pO86A1 [GenBank: NC_008460] [Browse all T4SS(s) in this replicon]
Location [Strand]66913..67272 [+]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDQ08JH2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 4.6e-59, Aligned region: 1..118
Protein Sequence: 119 a.a.     [Download]
>gi|116006879|ref|YP_788062.1| conjugal transfer pilin subunit TraA [Escherichia coli]
MNTVLSFQGASAPVEKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAQGQDLMQSGNSTVKATFG
KDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
 
Nucleotide Sequence: 360 bp     [Download]
>gi|116006783|ref|NC_008460.1|:66913-67272 Escherichia coli plasmid pO86A1, complete sequence
ATGAATACTGTTTTAAGTTTTCAGGGTGCTTCTGCGCCCGTTGAAAAGAAATCGTTTTTTTCTAAATTCA
CTCGTCTGAATATGCTTCGCCTGGCTCGCGCTGTGATCCCTGCTGCTGTTCTGATGATGTTCTTCCCGCA
ACTGGCAATGGCAGCACAGGGCCAGGACCTGATGCAGAGTGGTAACTCCACGGTTAAGGCGACCTTCGGT
AAGGACTCCAGTGTTGTTAAATGGGTTGTTCTGGCTGAAGTTCTGGTCGGTGCGGTCATGTACATGATGA
CCAAAAACGTCAAGTTCCTGGCCGGTTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGGCCGTCGT
TGGCCTCTGA